KEGG   Variovorax paradoxus EPS: Varpa_3302Help
Entry
Varpa_3302        CDS       T01392                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00790  Folate biosynthesis
vpe01100  Metabolic pathways
Module
vpe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Varpa_3302
Enzymes [BR:vpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Varpa_3302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PrmA
Motif
Other DBs
NCBI-ProteinID: ADU37487
UniProt: E6VB38
Position
complement(3553555..3554475)
Genome map
AA seq 306 aa AA seqDB search
MKSSNNGASGPVFHGEPGGSVWQTSRFRIDLAQPRVMGIVNVTPDSFSDGGAHASTDTAL
RHCEQLLKEGADILDIGGESTRPGSPAVPLDAELARVLPVVREAVKLNVPLSIDTYKPEV
MRAVLDLGADIVNDIWALRQPGAREAVAAHPSCGICLMHMHRDPQTMQVVPMQGDVIPEV
LSFWAAQLAQLHALQIDPSRITLDPGVGFGKTVTQNFALLGRQRELLGAGYPLLLGWSRK
SSIGTATGIEAAGERIVPSVAAAVLAVDRGAAIVRVHDVRDTVAALAVWRAMKAAAQQRQ
TKEELA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcaagcaacaacggggcctctggccccgttttccatggtgagccgggcggctcg
gtctggcagacctcgcgtttcaggatcgacctcgcgcagccgcgcgtcatgggcatcgtc
aacgtcacgcccgattccttctccgatggcggcgcgcacgcgtccaccgacaccgcgctg
cggcactgcgagcagttgttgaaggagggcgcggacatcctggacatcggcggggaatcc
acccgcccgggcagcccggccgttccgctcgacgccgaactggcgcgcgtgctgccggtt
gtgcgcgaggcggtgaagctgaacgtgccgctctccatcgacacctacaagcccgaggtc
atgcgcgctgtgctcgacctgggcgcggacatcgtcaacgacatctgggcgctgcgccag
ccgggtgcgcgtgaagccgtggcggcgcatccgtcgtgcggcatctgcctgatgcacatg
caccgcgatccgcagaccatgcaggtcgtgccgatgcagggcgacgtgatccccgaggtg
ctgtcgttctgggccgcgcagctggcgcaactccacgcgctgcagatcgatccgtcgcgc
atcacgctcgacccgggcgttggcttcgggaaaaccgtgacgcagaatttcgccctgctg
ggccggcagcgcgaattgctcggtgccggctacccgctgctcctgggctggtcgcgcaag
tcgtcgatcggcaccgccactggcatcgaggcggcgggcgagcgcatcgtgcccagcgtc
gcggccgcggtgctggccgtggaccgcggcgccgccatcgtgcgcgtgcacgatgtgcgc
gacacagtggccgccctcgcggtgtggcgcgccatgaaggcagcagcacaacaaagacaa
acaaaagaggaactcgcatga

DBGET integrated database retrieval system