KEGG   Variovorax paradoxus EPS: Varpa_3321Help
Entry
Varpa_3321        CDS       T01392                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00900  Terpenoid backbone biosynthesis
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Varpa_3321
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Varpa_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ADU37506
UniProt: E6VB57
Position
complement(3574379..3575566)
Genome map
AA seq 395 aa AA seqDB search
MNTPKQRVTVLGSTGSVGVSTLDVIARHPERYEVFALSAATKVDEMLAQCAQFSPRFAVM
ASPPHAALLAEKLKQNSLSTHVLTGEDAIEKIASHEEVDAVMAAIVGAAGLGPCLAAARA
GKRLLLANKEALVVGGELFMRTVREGGATLLPIDSEHSAIFQSLPEDPSTWARRIDKIIL
TASGGPFRTRAPETLGTVTPEQACAHPNWVMGRKISVDSATMMNKALEVIEARHLFGVLP
EQIEVVIHPQSVVHSMVQFTDASVIAQLGTPDMRVPIAVGLAWPERIESGAARLDFRQMA
SLTFDAPDAALFPGLGLAWHALRAAPGTTAVLNAANEVAVEAFLDRRLRFDRIHAVNMET
LEAVAPSKPASLADLLALDASARAAAKAAALRFAA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgaacactcccaaacaacgcgtcacagtgctggggtcgaccgggtcggtcggcgtgagc
acgctcgacgtcattgcgcggcatcctgagcgctacgaggtgtttgcgctgtccgcggcc
accaaggtcgatgagatgctggcgcagtgcgcgcagttctcgccccggttcgccgtcatg
gcgagcccgccgcatgcggcgttactggccgagaagctcaagcaaaacagcctgagcacc
catgtactgacaggcgaggatgctattgaaaagatagcctcgcacgaagaggtagacgcc
gtcatggctgccatcgtcggcgccgccgggctcggcccgtgcttggccgccgcgcgcgcc
ggcaagcgcctgctgctggccaataaggaagccctggtcgtcggcggcgaactgttcatg
cgcacggtgcgcgagggcggcgcgacgctgctgccgatcgacagcgagcattcggcgatc
ttccagtcgctgccagaggatccatccacctgggcgcggcgcatcgacaagatcatcctg
accgcgtcgggcggcccgttccgtacccgcgcgcctgagaccctgggcaccgtcacgccc
gagcaggcctgcgcccatcccaactgggtcatgggccgcaagatctcggtcgattcggcc
acgatgatgaacaaggcgctggaggtgatcgaggcgcgccacctgttcggcgtgttgccc
gagcagatcgaggtcgtcatccacccgcagagcgtggtgcattcgatggtgcagttcacc
gatgcctcggtcatcgcccagctcggcacgcccgacatgcgggtgccgatcgcggtcggc
ctggcttggcccgagcgcatcgagagcggggcggcacggctcgatttccggcagatggct
tcgctgactttcgatgcgcccgacgcggcgctcttccccggcctgggtcttgcgtggcac
gcattgcgtgcggcgcccggcactacggcagtgctcaacgcggccaacgaggtcgccgtc
gaggcctttctggaccggcgcctgcgtttcgatcgcattcatgcggtcaacatggaaact
ttggaagccgttgccccctccaagccggcgtcgctggccgatctgctggcgctcgatgcc
agcgcccgtgcggcggccaaggccgcagcgctgcgcttcgcagcctga

DBGET integrated database retrieval system