KEGG   Variovorax paradoxus EPS: Varpa_4753Help
Entry
Varpa_4753        CDS       T01392                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00450  Selenocompound metabolism
vpe00970  Aminoacyl-tRNA biosynthesis
vpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Varpa_4753
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Varpa_4753
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vpe01007]
    Varpa_4753
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vpe03016]
    Varpa_4753
Enzymes [BR:vpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Varpa_4753
Amino acid related enzymes [BR:vpe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Varpa_4753
Transfer RNA biogenesis [BR:vpe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Varpa_4753
 Prokaryotic type
   Other AARSs
    Varpa_4753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADU38914
UniProt: E6UYL1
Position
5175581..5177683
Genome map
AA seq 700 aa AA seqDB search
MSAPRKLFVTTALPYANGKFHIGHMMEYIQADIWVRNQRMNGAEVNFVCADDAHGAAITI
AADKAGVTPQAFVAEIAAGRKPYLDGYYISFDNWHSTDAPENHQLAQDIYRDLRANGLIE
TKSVEQFYDPEKGMFLADRFIKGECPNCHSKDQYGDNCEVCGAVYAPTELINPYSALSGA
KPELRSSDHFFFKLSDPRCEAYLKEWTAAPGHVQSEVQNKIREWLYKDDEGKGGLGDWDI
SRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKNLLDKRCIELGGDGISYTEYMADPDL
EQVHFIGKDIITFHTLFWPAMLHFSGRKAPDAVYVHGHLTVSGEKMSKSRGTGIDPLKYL
SIGLDPEWLRYYIAAKLNGRNEDIDFNPEDFVARVNSDLVGKYINIASRAAGFIGKRFGG
KLGEVSADGDALLFALREAAGQIHSLYDGRDYARALREVMALADKVNEYVDQNKPWELAK
KEGAEARLHDVCTVCIEAFRLLTLYLKPVLPALAVNVEAFLKISPLVWSDAAQPLPAGHA
IGEYKHLMQRADAKVVDKLFDAPEPVAAVAAAAEAATDSLPGGEAIAPTITIDDFVKIDL
RIAKIVACEKVEGSTKLLRLTLDAGEGKTRNVFSGIASAYQPEQLVGKLTVLVANLAPRK
MKFGISEGMVLAASHGDEKANPGIHVLEPWPGATPGMRVR
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccgcgcaagctcttcgtcaccaccgccctgccgtatgccaacggcaagttc
cacatcggccacatgatggaatacatccaggccgacatctgggtgcggaaccagcgaatg
aacggcgccgaggtcaacttcgtctgcgccgacgacgcgcacggcgcggccatcaccatc
gcggccgacaaggccggcgtgacgccgcaggccttcgtggcggagatcgcggcgggccgc
aagccctacctcgacggctactacatctcgttcgacaactggcactcgaccgacgcgccg
gagaaccaccagctcgcgcaggacatctaccgcgacctgcgcgccaacggcctcatcgag
accaagagcgtcgagcagttctacgaccccgaaaagggcatgttcctggccgaccgcttc
atcaagggcgagtgcccgaactgccattcgaaggaccagtacggcgacaactgcgaggtg
tgcggcgccgtgtacgcgcccaccgagctgatcaacccctactcggccctctcgggcgcc
aagcccgagctgcgcagctcggaccacttcttcttcaagctctcggacccgcgctgcgag
gcctacctgaaggaatggaccgccgcgcccggtcatgtgcagtccgaagtgcagaacaag
atccgcgaatggctctacaaggacgacgaaggcaagggaggcctgggcgactgggacatc
agccgcgacgcgccctacttcggcatcgagatccccgatgcgccgggcaagtacttctac
gtgtggctcgacgcgcccgtgggctacctcgcctcgctcaagaacctgctggacaagcgc
tgcatcgaactgggcggcgacggcatctcgtacaccgagtacatggccgacccggacctg
gagcaggtgcacttcatcggcaaggacatcatcaccttccacacgctcttctggcctgcg
atgctgcacttcagcggccgcaaggcgcccgacgcggtgtacgtgcacggccacctgacg
gtaagcggcgagaagatgagcaagagccgcggcaccggcatcgatccgctcaagtacctg
tcgatcggcctggaccccgagtggctgcgctactacatcgcggccaagctcaacggccgc
aacgaggacatcgacttcaaccccgaggacttcgttgcgcgcgtcaacagcgacctcgtg
ggcaagtacatcaacatcgcaagccgcgcggcgggcttcatcggcaagcgcttcggcggc
aagctgggcgaagtgtcggccgatggcgacgcgctgctgttcgcgctgcgcgaggcggcc
ggccagatccattcgctctacgacggccgcgactacgcccgtgcgctgcgcgaggtgatg
gcgctggccgacaaggtgaacgaatacgtcgaccagaacaagccctgggaactggccaag
aaagaaggcgccgaggcgcgcttgcacgacgtgtgcacggtgtgcatcgaggccttccgc
ctgctcacgctgtacctgaagccggtgctgccggcacttgcggtgaacgtcgaggccttc
ctgaagatctcaccgctggtgtggtccgacgccgcgcagcctctgcccgcgggccatgcg
atcggcgaatacaagcacctgatgcagcgcgccgatgccaaggtggtcgacaagctgttc
gatgcacccgagccggtggcagccgttgctgctgccgcggaagccgcgacggattcgctg
cccggcggcgaagccatcgcgccgacgatcaccatcgacgacttcgtgaagatcgacctg
cgcatcgccaagatcgtggcctgcgagaaggtcgagggctcgaccaagctgctgcgcctg
acgctcgacgcgggcgaaggcaagacccgcaacgtcttcagcggcatcgcctcggcctat
cagcccgagcagctcgtgggcaagctcacggtgctggtcgcgaacctcgcgccgcgcaag
atgaagttcggcatcagcgaaggcatggtgctggccgcaagccacggcgacgaaaaagcc
aacccgggcatccacgtgctcgaaccgtggccgggcgcaacgccgggcatgcgggttcgc
tga

DBGET integrated database retrieval system