KEGG   Variovorax paradoxus EPS: Varpa_4792Help
Entry
Varpa_4792        CDS       T01392                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Varpa_4792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vpe01007]
    Varpa_4792
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vpe03016]
    Varpa_4792
   03029 Mitochondrial biogenesis [BR:vpe03029]
    Varpa_4792
Enzymes [BR:vpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Varpa_4792
Amino acid related enzymes [BR:vpe01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Varpa_4792
Transfer RNA biogenesis [BR:vpe03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Varpa_4792
 Prokaryotic Type
   Other AARSs
    Varpa_4792
Mitochondrial biogenesis [BR:vpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Varpa_4792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ADU38953
UniProt: E6UZR7
Position
complement(5206480..5208288)
Genome map
AA seq 602 aa AA seqDB search
MAMRTHYCGLVTEALLGQTVTLCGWVNRRRDHGGVIFIDVRDREGYVQVVCDPDRASTFA
VAENLRNEFCVQITGLVRSRPEGTTNDSLKSGKIEVLCHELKVLNPSVTPPFLLDDDNLS
ETTRLTHRVLDLRRPAMQRNMMLRYKVTMETRKFLDANGFIDIETPMLGKSTPEGARDYL
VPSRVHDGSFFALPQSPQLFKQLLMVAGYDRYYQIVKCFRDEDLRADRQPEFTQIDIETS
FLAEEEIREMFEGMIRNVFRNAAGIDLPVFPTMTYGDAMFKYGSDKPDLRVKLEFTELTE
LMKRVEFKVFSNAATQKDGRVVALRVPGGGGEGGLSRGEIDAYQEFVKIYGAKGLAYIKV
NDAAAGREGLQSPIVKNLDDNTLAEIIARTGARNGDILFFGADKEKVVNDAIGALRVKIG
HSAFGKKSGLFDDRWAPLWVVDFPMFEFDEEGQRWSAVHHPFTAPKDGHEDLMDTAPEKC
IAKAYDMVLNGIEMGGGSVRIHREEVQSKVFRALKISAEDAQLKFGFLLDALQYGAPPHG
GIAIGLDRLVMLMTGAESIRDVIAFPKTQRAQDLLTQAPSPVDEKQLRELHIKLRNTPQA
AA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcgtactcactattgcggtcttgtgaccgaagccctgttgggccagaccgtc
accctgtgcgggtgggtcaaccgtcgccgtgaccacggcggcgtgatcttcatcgacgtg
cgcgaccgcgaaggttacgtgcaggtggtgtgcgaccccgatcgcgcctccaccttcgcc
gtggccgagaacctgcgcaacgagttctgcgtgcagatcaccggcctcgtgcgttcgcgc
cccgaaggcacgaccaacgacagcctcaagagtggcaagatcgaagtgctgtgccatgag
ctgaaggtgctcaacccgtcggtcacgccgccgttcctgctggacgacgacaacctctcg
gaaaccacccgcctcacgcaccgcgtgctcgacctgcgccgtccggccatgcagcgcaac
atgatgctgcgctacaaggtgacgatggaaacgcgcaagttcctcgatgccaacggcttc
atcgacatcgagacgccgatgctgggcaagtccacgcccgaaggcgcgcgcgactacctc
gtgcccagccgtgtgcacgacggcagcttcttcgcgctgccgcagtcgccgcagctcttc
aagcagctcttgatggtggccggctacgaccgctactaccagatcgtgaagtgcttccgc
gacgaagacctgcgcgccgaccgccagcccgaattcacgcagatcgacatcgagacctcg
ttcctcgccgaagaggaaatccgcgagatgttcgaaggaatgatccgcaacgtgttccgc
aatgccgcgggcatcgacctgccggtgttcccgaccatgacgtacggcgatgcgatgttc
aagtacggctcggacaagcctgacctgcgcgtgaagctcgaattcaccgaactcaccgag
ctgatgaagcgggtcgagttcaaggtgttctcgaacgccgcgacgcaaaaggacggtcgc
gtggtcgcattgcgtgtgcctggcggcggcggcgagggcggcttgtcgcgcggtgaaatc
gacgcgtaccaagagttcgtcaagatctacggcgcaaagggcctcgcctacatcaaggtg
aacgacgcggctgccggccgcgaaggcctgcagagcccgatcgtgaagaacctggacgac
aacacgctggccgagatcatcgcccgcacgggtgcgcgcaacggcgacatcctgttcttc
ggcgccgacaaggaaaaggtcgtcaacgacgccatcggcgcgctgcgcgtgaagatcggc
cacagcgccttcggcaagaagagcggcctgttcgacgatcgctgggcgccgctctgggtg
gtcgatttcccgatgttcgagttcgacgaggaaggccagcgctggagcgccgtgcaccat
ccgttcaccgcaccgaaggacggccatgaagacctcatggacaccgcccccgagaagtgc
atcgccaaggcctacgacatggtgctcaacggcatcgagatgggcggcggctcggtgcgt
atccaccgcgaggaagtgcagagcaaggtgttccgtgcgctgaagatcagcgctgaggac
gcacagctcaagttcggcttcctgctcgacgcgctgcagtacggcgccccgccgcacggc
ggcatcgccatcggcctggaccgcctggtcatgctgatgaccggcgccgagtcgatccgc
gacgtgatcgccttccccaagacccagcgcgcgcaagacctgctgacgcaggcgccgagc
ccggtcgacgagaagcagctgcgcgaactgcacatcaagctgcggaacacgccgcaagcc
gcagcctga

DBGET integrated database retrieval system