KEGG   Variovorax paradoxus EPS: Varpa_4850Help
Entry
Varpa_4850        CDS       T01392                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00260  Glycine, serine and threonine metabolism
vpe00750  Vitamin B6 metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01230  Biosynthesis of amino acids
Module
vpe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_4850
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Varpa_4850
Enzymes [BR:vpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Varpa_4850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DnaB_C
Motif
Other DBs
NCBI-ProteinID: ADU39011
UniProt: E6UZX5
Position
complement(5267882..5269138)
Genome map
AA seq 418 aa AA seqDB search
MTPSPVLDFKFAALPADPSAHRSGNPAASALARTLKPVRNPRLRGLQCLRCDALYPVTLT
HDGCPACKRAGFHVALRASYLPDLGNQTERAEGHDAIPMPYASGFTLGEGQTPMLEMTEL
ARHFDVARLGLKDESSNPTGSHKDRMTAVGVAQALDFGAHTLVLASSGNAAVSAAHYAWA
AGLRCEVATYEGMPATYSRQLDALGARRYVFADNAGRWAFVRERSQYPGYFALTNYRLPA
LGSAPLAIEGYKTIAPECVADAGLPDHIVIPTARGDLAWGIYAGFRDLLAAGRIPRLPRL
WLVEPFPRLARVFAGGAINGSYPGHTAQFSTAGATVTYLQWQAASATGGGAVVVSDDEAR
AARRLLTAAGVSAELCAAGGLAALRQLRESGAIAADAHVVLMLTANASSDPSWPDPAV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccctcgccagttctggacttcaagttcgccgccttgccagcggacccctcggcc
catcgttcggggaatcccgccgcctccgccctggcccgcacgctcaagccggtgcgcaat
ccgcgcttgcggggcctgcagtgcctgcgctgcgatgcgctctacccggtcacgctgacg
cacgacggctgccccgcctgcaagcgcgcgggctttcacgtcgcattgcgcgcgagctac
ctgcccgacctggggaaccagacagagcgagcagaaggccacgatgcgatccccatgccc
tatgcgtcgggcttcaccctcggcgagggccagacgccgatgctggagatgacggagctt
gcgcggcatttcgacgtcgcgcggctcggcctcaaggacgaatcgagcaaccccaccggc
tcgcacaaggaccggatgacggcggtgggcgtggcgcaggcgctggacttcggcgcccac
acgctggtgctcgcatcgtcgggcaatgccgcggtgtcggcggcgcactacgcgtgggcg
gcgggcctgcgctgcgaggtcgcgacctacgaaggcatgccggcgacctattcgcgccag
ctcgatgcgctgggcgcgcggcgctatgtgttcgccgacaacgccggccgctgggccttc
gtgcgcgagcgctcgcagtaccccggctacttcgcgctgaccaactaccgtttgcctgcg
ctcggcagtgcgccgctggccatcgagggctacaagacgattgcgcccgagtgcgtggcc
gacgccggcctgccggaccacatcgtgattcccaccgcgcgcggcgacctcgcctggggc
atctacgcgggctttcgcgacctgctggccgcggggcgcattccgcgcctgccgcggctc
tggctggtggagccgtttccgcgcctcgcacgcgtgttcgcgggtggcgcgatcaacggc
agctatcccggccacaccgcgcagttctcgacggcgggcgccaccgtgacctacctgcag
tggcaggccgccagcgccacgggcggcggcgcggtggtggtgagcgacgacgaggcgcgt
gcggcgcggcggttgctcacggctgccggcgtgagcgccgaactgtgcgcggccggcggc
ctggccgcgctgcggcaactgcgcgagagcggtgccatcgccgccgacgcgcatgtggtg
ctgatgctcacggccaacgcgtcgagcgatccgagctggcccgatccggccgtctga

DBGET integrated database retrieval system