KEGG   Variovorax paradoxus EPS: Varpa_5373Help
Entry
Varpa_5373        CDS       T01392                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00071  Fatty acid degradation
vpe00072  Synthesis and degradation of ketone bodies
vpe00280  Valine, leucine and isoleucine degradation
vpe00310  Lysine degradation
vpe00362  Benzoate degradation
vpe00380  Tryptophan metabolism
vpe00620  Pyruvate metabolism
vpe00630  Glyoxylate and dicarboxylate metabolism
vpe00640  Propanoate metabolism
vpe00650  Butanoate metabolism
vpe00900  Terpenoid backbone biosynthesis
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
vpe01212  Fatty acid metabolism
vpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Varpa_5373
   00630 Glyoxylate and dicarboxylate metabolism
    Varpa_5373
   00640 Propanoate metabolism
    Varpa_5373
   00650 Butanoate metabolism
    Varpa_5373
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Varpa_5373
   00072 Synthesis and degradation of ketone bodies
    Varpa_5373
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Varpa_5373
   00310 Lysine degradation
    Varpa_5373
   00380 Tryptophan metabolism
    Varpa_5373
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Varpa_5373
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Varpa_5373
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Varpa_5373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpe04147]
    Varpa_5373
Enzymes [BR:vpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Varpa_5373
Exosome [BR:vpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Varpa_5373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADU39529
UniProt: E6V8A5
Position
complement(5836500..5837684)
Genome map
AA seq 394 aa AA seqDB search
MSESIVIVGAARTPMGGFQGDFASLSAHDLGGAAIKAAVERAGIAPESVGEVLFGNCLMA
GQGQAPARQAAYKGGLPDSAGAVTLSKMCGSAMKAAMLAHDLLLAGTHDVIVAGGMESMT
NAPYLMLKGRGGYRMGHDKIYDHMMLDGLEDAYQPGRSMGTFGEDCAAKYKFTREQQDAF
AIASVQRAKAATESGAFKEEITPVTVKGRGGDTVISIDEGPGKVKLDKIPTLKPAFKKEN
GTITAASSSSINDGAAALVMMTESHAKKIGAKPIARIVGHATHAQEPEWFSTAPVGAVAK
LFKKTGWTVKDVDLWEVNEAFAVVPMALMHELDVSHDIVNVNGGACALGHPIGASGARIM
VTLIHALKARGKKRGVATLCIGGGEGTAVALELL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaatccatcgtcatcgtcggcgccgcccgcacccccatgggtggctttcaaggc
gactttgcttccctctccgcgcacgacctcggtggcgctgccatcaaggccgccgtcgag
cgcgccggcatcgcccccgagagcgtgggcgaagtgctgttcggcaactgcctcatggcc
ggccagggccaggccccggcgcgccaggccgcgtacaagggcggcctgcccgacagcgcg
ggcgcggtcacgctcagcaagatgtgcggctcggccatgaaggccgcgatgctcgcgcac
gacctgctcttggccggcacgcacgacgtgatcgtcgcgggcggcatggaaagcatgacc
aacgccccctacctcatgctcaagggccgaggcggctaccgcatgggccacgacaagatc
tatgaccacatgatgctcgacggcctggaagacgcttaccagccgggccgctcgatgggc
accttcggcgaggactgcgcggccaagtacaagttcacccgcgagcagcaggacgccttc
gccatcgcgagcgtgcagcgcgccaaggccgcgaccgaatcgggtgcgttcaaggaagaa
atcacacccgtcaccgtgaagggccgcggcggcgacaccgtgatctccatcgacgaaggc
ccgggcaaggtcaagctcgacaagatccccacgctcaagcccgcgttcaagaaagaaaac
ggcaccatcaccgccgcatcgagctcgtcgatcaacgacggcgccgcggcgctggtgatg
atgaccgagtcgcacgcgaagaagatcggcgccaagcccatcgcccgcatcgtcggccac
gccacgcatgcgcaggaacccgagtggttctcgaccgcgcccgtcggtgcggtggccaag
ctgttcaagaagaccggctggaccgtgaaggacgtcgacctctgggaagtgaacgaggcc
ttcgccgtggtgccgatggcgctgatgcacgagctcgacgtgtcgcatgacatcgtcaac
gtgaacggcggcgcctgcgcgctgggccacccgatcggcgcgagcggcgcgcgcatcatg
gtcaccttgatccacgcgctgaaggcgcgcggcaagaagcgcggcgtggcgacgctgtgc
atcggcggcggcgaaggcaccgccgtggcactcgaattgctctaa

DBGET integrated database retrieval system