KEGG   Variovorax paradoxus EPS: Varpa_5528Help
Entry
Varpa_5528        CDS       T01392                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Varpa_5528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_5528
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_5528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 Clp_N ClpB_D2-small AAA_16 AAA_22 Sigma54_activat TniB AAA_7 NACHT SRP54 AAA_25 AAA_23 T2SSE DUF2075 DUF815
Motif
Other DBs
NCBI-ProteinID: ADU39683
UniProt: E6VAD9
Position
complement(6015843..6018563)
Genome map
AA seq 906 aa AA seqDB search
MSTSLKTLITKLNASARMATQRAANLCLANGHYEVDLEHLFLALLEQTDNDLARVLRANR
ISATAIQSDLEREIQTFKNGNTRTPVFSQHLQQLFQQAWLLASLDAHVAQIRSGHLLLAL
LTEPDLAQLAQRGSPLFAKIRLEDLKHDFDKLTDGSSEAAEAGASGGAATEGDAQQAPAD
ALAAGVPGKTPALDQFTTNLTQRAKDGALDPVIGRDTEIRQVIDILMRRRQNNPILTGEA
GVGKTAVVEGLALRIATEDVPESLRAVALHTLDMGLLQAGASVKGEFENRLKNVIAEVKK
SPHPIVLFIDEAHTMIGAGGQAGQSDAANLLKPALARGELRTIAATTWGEYKKYFEKDAA
LARRFQVVKVEEPSETLAAAMLRGMVPLMEKHFNIRVLDEAITEAVRLSHRYISGRQLPD
KAVSVLDTACAKVALGQSATPALIEEANRGLERIEAESAALVRDTAAGGRHEVRLAELAE
KKSALQAELAASQQRLAEENALVERIRALRAQRDESAAQPEAAPAEKAPARAASRKKSAT
SADPERDQLDALLAELRALQGTTPMVPLQVDGHVVAEIVSAWTGVPLGRMVKDEIKTVRA
LDTLLAERVIGQDHALAAVAQRVRTASARLEDPNKPRGVFMFVGPSGVGKTETALALADI
LYGGEKKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRQPYSVVLLDEVEK
AHPDVLEMFFQVFDKGMMDDAEGREIDFRNTLIILTSNIGSSQIMQACLNKADDERPAPD
ALADALRPVLMKAFKPAFLGRMKVAPFYPITDAVLEQIIALKLGRIRDRIATNHKAVFEW
DDALVEAVLARCTEVDSGARNVDHILNGTLLPEIAEAVLTRMADETPLAKIKASCAKSGE
FRYRIS
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatcgctgaaaacactgatcaccaagctcaacgccagcgcacgcatggccacg
cagcgcgcggccaatctgtgcctggccaacggccactacgaagtggacctggagcacctg
ttcctggcgctgctggagcagaccgacaacgacctcgcgcgcgtgctgcgcgccaaccgc
atcagcgcgaccgcgatccagtcggacctggagcgcgagatccagaccttcaagaacggc
aacacgcgcacgccggtgttctcgcagcacctgcagcagttgtttcagcaggcgtggctc
ctggcctcgctcgatgcgcacgtggcgcagatccgctcgggccacctgctgctcgcgctg
ttgaccgaacccgacctcgcacaactcgcgcagcgcggctcgccgctgttcgcgaagatc
cgcctcgaagacctgaagcacgacttcgacaagctcaccgacggttcgagcgaagcggcc
gaagccggcgcctcgggcggtgcggccacggaaggcgacgcgcagcaagcgccggccgat
gcgctggccgcgggcgtgcccggcaagacgcccgcgctcgaccagttcaccaccaacctc
acgcagcgcgcgaaagacggtgcgctcgacccggtgatcggccgcgacaccgagatccgc
caggtcatcgacatcctgatgcgccggcgccagaacaaccccatcctcaccggcgaggcc
ggggtcggcaagacggcggtggtcgaggggttggcgttgcgcatcgcgacagaggacgtg
cccgagtcgctgcgcgccgtggcgctgcacacgctggacatgggccttctgcaggccggc
gcgagcgtgaagggcgagttcgagaaccgcctgaagaacgtgatcgccgaagtgaagaag
agcccgcatccgatcgtgctcttcatcgacgaggcccacacgatgatcggcgcgggcggc
caggccgggcagagcgatgcggccaacctgctcaagcccgcgctcgcgcgcggcgaactg
cgcaccatcgccgccacgacctggggcgaatacaagaaatacttcgagaaggacgcggcg
ctcgcgcggcgcttccaggtcgtgaaggtcgaggagcccagcgaaacgctggctgccgcc
atgctgcgcggcatggtgccgctgatggaaaagcacttcaacatccgcgtgctcgacgaa
gccatcaccgaggcggtgcgcctgtcgcaccgctacatcagcggccgccagctgcccgac
aaggcggtgagcgtgctcgacaccgcgtgcgcgaaagtggcgctcggccagagcgcgacg
ccggcgctgatcgaggaagcgaatcgcggcctcgaacgtatcgaggccgagagtgccgcg
ctggtgcgcgacaccgcggccggcgggcgccatgaagtgcggctggccgaactggcggaa
aagaagagcgcgctgcaggccgagcttgctgcgagccagcagcgccttgccgaagagaac
gcgctggtcgaacgcatccgtgcactgcgcgcgcaacgcgacgagtcggctgcacagccc
gaggctgcacccgcagagaaggcccccgcacgtgccgcgagccgcaagaaatccgcgacc
agtgcggaccccgaacgcgaccaactcgatgccctgctcgccgagctgcgcgcgctgcaa
ggcaccacgccgatggttccactgcaggtcgacggccacgtcgtcgccgagatcgtctcg
gcctggaccggcgtgccgctcggccgcatggtcaaggacgaaatcaagaccgtgcgcgcc
ctcgatacgctgctggccgaacgcgtgatcggccaggaccacgcgctcgccgccgtcgcc
cagcgcgtgcgcaccgccagcgcgcgcctggaagaccccaacaagccgcgcggcgtgttc
atgttcgtcggcccctcgggcgtgggcaagaccgagaccgcgctcgcgttggccgacatc
ctctacggcggcgagaagaagctcatcaccatcaacatgagcgagtaccaggaggcgcac
agcgtctcgggcctgaagggatcgccgcccggctacgtgggttatggcgaaggcggcgtg
ctcaccgaagccgtgcgccgccagccttacagcgtggtgctgctcgacgaagtcgagaag
gcgcaccccgatgtgctggagatgttcttccaggtgttcgacaaagggatgatggacgac
gccgagggccgcgagatcgactttcgcaacacgctgatcatcctcacctcgaacatcggc
tcgtcgcagatcatgcaggcgtgcctgaacaaggccgacgacgagcgccccgcgcccgac
gcgctggccgatgcgctgcgccccgtgctcatgaaggccttcaagccggcctttctcggc
cgcatgaaagtggcgccgttctatccgatcaccgatgcggtgctcgaacagatcatcgcg
ctcaagctgggccgcatccgcgaccgcatcgcgaccaaccacaaggcagtgttcgagtgg
gacgacgcgctggtggaggccgtgcttgcgcgctgcaccgaggtcgattcgggcgcgcgc
aacgtcgatcacatcctgaacggcacgctcctgcccgagatcgcggaagcggtgctcacg
cgcatggcggacgagacgccgctcgcgaagatcaaggcgagctgcgccaagagcggcgag
ttccgctacaggatcagctag

DBGET integrated database retrieval system