KEGG   Variovorax paradoxus EPS: Varpa_5531Help
Entry
Varpa_5531        CDS       T01392                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
vpe  Variovorax paradoxus EPS
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpe02044]
    Varpa_5531
Secretion system [BR:vpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Varpa_5531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ADU39686
UniProt: E6VAE2
Position
complement(6021576..6022067)
Genome map
AA seq 163 aa AA seqDB search
MNGFEPGLLDKLFDDDWRGPASPVLRHLSLEEVKNMVARDLESLLNTRMVFNDAKLESFP
ECRRSVMTYGLSDFSGLSLASHYDRSFICRSLEQAIARHESRLRDVVVTLEVDGQTSTNM
LYFGITALLVLPELAEPVNFDAMLQPTTLQYSITRGTGKSRSA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatggattcgaaccgggcttgctcgacaaactcttcgatgacgactggcgcgggccg
gcttcgccggtgctcaggcacctgtcgctcgaagaggtcaagaacatggtcgcgcgcgac
ctcgaatcgctgctcaacacgcgcatggtcttcaacgacgcgaagctcgagtcgtttccc
gagtgtcggcgttccgtcatgacctacggcctgagcgatttctcgggcctgagccttgcg
agccactacgaccgctcgttcatctgccgctcgctggagcaggccattgcccgccacgag
tcgcggctgcgcgacgtcgtcgtgacgctcgaggtcgacggccagaccagcaccaacatg
ctctatttcggaatcaccgccctgctcgtgctgcccgagctcgccgagccggtgaacttc
gacgcgatgctgcagcccacgacgctgcagtactcgatcacacgcggcaccggcaagagc
cgctctgcctga

DBGET integrated database retrieval system