KEGG   Variovorax paradoxus EPS: Varpa_5770Help
Entry
Varpa_5770        CDS       T01392                                 

Definition
(GenBank) ribosomal protein L5
  KO
K02931  large subunit ribosomal protein L5
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe03010  Ribosome
Module
vpe_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Varpa_5770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vpe03011]
    Varpa_5770
Ribosome [BR:vpe03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Varpa_5770
  Bacteria
    Varpa_5770
  Archaea
    Varpa_5770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5
Motif
Other DBs
NCBI-ProteinID: ADU39922
UniProt: E6UWJ2
Position
complement(6271648..6272187)
Genome map
AA seq 179 aa AA seqDB search
MARLQQHYREKIAKDLTEKFGYKSPMQVPRLTKITLNMGVGEAVADKKVLDNAVADLTKI
AGQKPVVTKSKKAIAGFKIRENQPIGCMVTLRGVQMYEFLDRFVTIALPRVRDFRGISGR
AFDGRGNYNIGVKEQIIFPEIEYDKVDALRGLNISITTTAKTDEEAKALLAGFRFPFKN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtctccaacaacactatcgcgaaaagatcgcgaaagacctgacggaaaagttc
ggctacaagtcgccgatgcaggtcccccgtctcaccaagatcaccctgaacatgggtgtg
ggtgaagcagtcgccgacaagaaggttctcgacaacgctgtcgccgacctgaccaagatc
gccggccagaagcccgtggtcaccaagtcgaagaaggctatcgcgggtttcaagatccgc
gaaaaccagccgatcggctgcatggtcacgctgcgtggcgtgcagatgtatgagttcctg
gaccgtttcgtgaccatcgcgctgccgcgtgttcgcgacttccgcggcatctccggccgt
gcgttcgatggccgtggcaactacaacatcggcgtcaaggaacagatcattttccctgag
atcgagtacgacaaggtcgatgccctgcgcggtctcaatatcagcatcacgacgacggcc
aagaccgacgaagaagccaaggcgcttctcgctggcttccgtttcccgttcaagaactga

DBGET integrated database retrieval system