KEGG   Variovorax paradoxus EPS: Varpa_5881Help
Entry
Varpa_5881        CDS       T01392                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00480  Glutathione metabolism
vpe00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Varpa_5881
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Varpa_5881
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Varpa_5881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin DUF5046
Motif
Other DBs
NCBI-ProteinID: ADU40033
UniProt: E6UYQ8
Position
6400635..6401249
Genome map
AA seq 204 aa AA seqDB search
MRTLFLLSTLWRCTPAVSLVAALFTALPASAQTPPAAPAPAEAAGCPAILQHTFPRLQDE
KPQTLCQYSGKVVLVVNTASFCGFTPQYKGLEALDLKYRNRGLVVLGFPSNDFSQESGSN
KEIADFCESTFGVKFPMFAKSSVRGTDANPLFKQLAQASGTTPKWNFYKYLIGRDGKVVQ
AWSSMTAPDENGFVNVIEKQLGTN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacccttttcttattgtcgacgctctggcgctgcacaccggcagtttccctcgtg
gcggcgctgtttacggcgcttccggcgagtgcccagacaccgcccgccgcgcccgctccg
gcagaggctgcaggctgccccgccatccttcaacacaccttcccgcggctgcaggacgaa
aagccccagactttgtgccagtactccggaaaggtggtcctggtggtcaatacggcgagc
ttctgcggctttaccccgcaatacaagggcctggaagcactggacctgaaataccgcaac
cgcgggctggtggttctgggcttcccgtcgaacgatttctcgcaggaatcgggctccaac
aaggaaatcgccgacttctgcgaaagcaccttcggcgtgaagtttccgatgttcgccaag
tcgtcggtgcgtggaacggacgccaatccgctgttcaagcaactcgctcaagcctcgggc
accacgccgaagtggaatttctacaagtacctgatcgggcgcgacggcaaggtcgtccag
gcttggtcgagcatgacggcgccggatgaaaacggcttcgtgaacgtcatcgagaagcag
ctcgggacaaattaa

DBGET integrated database retrieval system