KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_00295Help
Entry
M634_00295        CDS       T02761                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00670  One carbon pool by folate
vpf01100  Metabolic pathways
vpf01120  Microbial metabolism in diverse environments
vpf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    M634_00295 (metF)
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     M634_00295 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AGQ89477
UniProt: S5IHF5
Position
I:complement(56728..57630)
Genome map
AA seq 300 aa AA seqDB search
MGYTHAGHIDALNQNIAELSDNINVSFEFFPPSSEKMEETLWNSVHRLKTLKPKFVSVTY
GANSGERDRTHSIIKEIKAETGLVAAPHLTCIDATRSELIEIADDYWNNGIENIVALRGD
IPPGGGAPDMYASDLVELLKSRHDFDISVAAFPEVHPEAKSAQSDLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVSNFKQASRFAAQNNVKVPGWMSKQFE
GLDDDPVTRQLVGASQAIDMVRVLSREGVKDFHFYTLNRAEMTYALCHTLGVRPRVAVEA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgggatacacgcacgcaggccatatcgacgccttaaaccagaatattgctgagttgtca
gataacattaatgtctcgtttgagttttttccgccaagcagcgaaaagatggaagaaacg
ctgtggaactctgtgcatcgtctaaaaacgctcaagcctaaatttgtttcggtaacatac
ggagcaaactctggtgagcgtgatagaactcactccattatcaaggaaatcaaagcagag
accggcttagttgctgcgcctcacctcacttgtatcgatgcaacacgttcagagttgatt
gagattgctgatgattactggaataacggcatcgaaaatatcgttgcgctgcgtggtgac
atcccacctggtggcggtgctccagatatgtatgcttcggacttggttgagctactaaaa
tctcgtcacgattttgatatttctgtggcggcttttccagaagtgcatccagaggcaaaa
agtgctcaatcggatctgctaaacctaaagcgtaaagtggacgctggtgcaaaccgtgcc
attactcagttcttctttgatgtggaatcttatctgcgttttcgtgaccgctgtgttgcg
gcgggaatcgatgtagaaatcgtaccgggtattttgccagtatcgaactttaaacaagcc
tcacgctttgccgcgcagaataacgttaaagtgccaggatggatgagcaaacagtttgaa
ggtttggatgatgatcctgtgactcgccaacttgtaggtgcaagccaagctattgatatg
gttcgtgtactaagtcgcgaaggtgtaaaagatttccacttctatacgctgaatcgtgcg
gagatgacttatgcgttatgccatactttgggtgttcgccctcgtgtagccgtagaagcg
taa

DBGET integrated database retrieval system