KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_03815Help
Entry
M634_03815        CDS       T02761                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00051  Fructose and mannose metabolism
vpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    M634_03815
Enzymes [BR:vpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     M634_03815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 Sacchrp_dh_NADP ApbA DotD
Motif
Other DBs
NCBI-ProteinID: AGQ90034
UniProt: S5INB6
Position
I:complement(757561..758709)
Genome map
AA seq 382 aa AA seqDB search
MKNAVHFGAGNIGRGFIGKLLADAEVEVTFADVDAPLVDQLSHKQEYKVKVVGTECQIDT
VTHVTAVNSASDDVIDRIVKTDLVTTAVGPNVLDIIAKTIAKGIAKRFEAGNDAPLNIIA
CENMVRGTTHLKGEVYKHLDKSLHAKADELVGFVDSAVDRIVPPAEAANDDPLEVTVESF
SEWIVDEQQFKGDIPNIAGMEKTNNLMAFVERKLFTLNTGHCITAYLGCLKGHRTIREAI
EDPSIHAEVKQAMQESGEVLIRRYGFDRDMHNAYIEKILGRFANPYLVDEVDRVGRQPIR
KLGANDRLVKPLLGTIEYGTENQTLLKGIAAALKYTNDTDPQAVELQTSLKEVGVTKTLA
KYTGLAEDSVEVAQIEVIYHQL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagttcattttggtgcaggtaacatcggtcgtggtttcatcggtaaactc
ttagcagacgcagaagtcgaggtcactttcgctgacgttgatgcgccgttggtagaccag
ctcagccacaaacaagaatacaaagtgaaagtcgtgggcaccgagtgccaaatcgatact
gttacccacgtcacagccgtaaactcagccagtgatgacgtgattgatcgcatcgtcaaa
accgatttagttaccacagcggtcggtccaaacgtattagatatcatcgcgaaaaccatc
gcgaaaggtatcgccaaacgttttgaagctggcaatgacgcgccacttaacatcatcgcc
tgtgaaaatatggtgcgtggcacaacgcacctaaaaggtgaagtgtacaaacacttagat
aaatcattgcatgcaaaagcagacgagttggttggctttgttgattccgctgtcgatcgc
atcgtgccaccagcagaagccgccaacgatgacccattggaagtgactgttgaaagcttc
agcgaatggattgtcgatgagcaacagttcaagggcgacatcccaaacattgctggcatg
gaaaaaaccaacaacctaatggcattcgtagaacgtaagctgttcaccttaaacacaggt
cactgcattaccgcttatttaggctgtttgaaaggccatcgcaccattcgcgaagcgatt
gaagacccaagcattcatgccgaagtaaaacaagcaatgcaggaaagtggcgaagtattg
attcgtcgttacggcttcgaccgtgacatgcacaatgcctacatcgaaaagattttaggt
cgcttcgccaacccatatttagtggatgaagtggatcgcgttggacgacaaccaattcgt
aaattgggtgcaaatgatagattagtgaagccattactcggtacaatcgagtatggcact
gaaaatcaaacacttttgaaagggatcgcggcggcgttgaaatacaccaacgacaccgat
ccgcaagcggttgagctacaaacctcattaaaagaggttggcgtgacaaaaacgctagca
aaatacacaggtctggctgaagacagtgttgaagtggctcaaatcgaagtgatttaccac
cagctttaa

DBGET integrated database retrieval system