KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_08660Help
Entry
M634_08660        CDS       T02761                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00350  Tyrosine metabolism
vpf00643  Styrene degradation
vpf01100  Metabolic pathways
vpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    M634_08660
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    M634_08660
Enzymes [BR:vpf01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     M634_08660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGQ90810
UniProt: S5IS63
Position
I:1816278..1816946
Genome map
AA seq 222 aa AA seqDB search
MGDDIILYGYWRSSAAYRVRICLNLKQLAYDSVSVHLVRNGGEQHNEQYHDLNASELVPV
LVDGDLRLNQSLAIIQYLEENYPDVSVIPEQTPLRYQALAMAQDIAMEIHPLNNLRVLQY
LEGTLGCEQAQKEEWIHHWIKQGFAALEEKLAKYREEHGNCKYSVTDSPCIVDICLVPQV
YNAQRFGVDMSPYPVINAIVDACNQLPTFIDAMPDNQPDANT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgacatcattctttatggatattggcgatcttcggcggcatatcgagtgcgt
atatgcttgaatttaaagcaactggcgtatgattcagtgtctgttcacttagttcgcaat
ggcggtgaacagcacaatgagcaataccacgatcttaacgcctcagagctggtccctgtg
ctggtggatggcgacttacgcttaaatcagtcactcgcgatcattcaatatcttgaagaa
aactacccagatgtgtcggtcattcctgaacaaacgccattacgttatcaagcgttggcg
atggcgcaggacatcgccatggaaattcatcctttaaacaatctgcgtgtcttgcagtat
ctggaaggaacactaggttgtgaacaagcgcagaaagaggagtggattcatcactggatc
aaacaaggctttgctgcgttagaagagaaactggccaaatatcgagaagagcatggaaac
tgtaaatacagtgtgactgactcgccatgcatcgttgatatttgccttgtgcctcaagtc
tacaacgcgcaacgttttggagttgatatgtcgccttatccggttatcaacgcaattgta
gatgcttgcaaccaactgccaactttcattgatgccatgccagacaatcaaccagacgct
aacacttaa

DBGET integrated database retrieval system