KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_14005Help
Entry
M634_14005        CDS       T02761                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vpf03016]
    M634_14005
Enzymes [BR:vpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     M634_14005
Transfer RNA biogenesis [BR:vpf03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    M634_14005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AGQ92447
UniProt: S5IQK2
Position
I:complement(2898763..2899530)
Genome map
AA seq 255 aa AA seqDB search
MSEQETSQTVAPVELEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQFVMQTLRDQIGQHV
FPLHRLDRPTSGVLVFALSSEVASQVMPMFAEHKMEKTYHAIVRGWIEEEGVLDYALKVE
LDKIADKFASQEKEAQEAVTAYKPLAKVEVPYSTGKFPTTRYCLMEMKPKTGRKHQLRRH
MAHLRHPIVGDTSHGDGKHNKLFRNEFDSHRLLLHASELRFVHPFTNEELVMKASIDDTW
QQLFTRFEWDEELVK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaagaaacatcacaaaccgtggctccagtagagttggagattgtttatcaa
gatgagtattttgttgcggtgaacaagcccgccggcatgttggttcatcgcagttggcta
gataaacacgaaactcagtttgtcatgcagactctgcgagaccaaattggtcagcatgtc
tttccgttgcatcgcttggatcgtccgacttctggcgttttggtgtttgcgctctccagt
gaagtggcttctcaagtgatgccaatgtttgctgagcacaaaatggagaagacctatcac
gcgattgtccgtggttggattgaggaagagggcgttttagattacgcgttaaaagtcgaa
ttagacaaaattgcagataagttcgcctcacaagagaaagaagctcaagaggccgtaacc
gcttacaaaccactggcgaaagtggaagtgccttattcgacgggcaagttcccaacaacg
cgctactgtttgatggaaatgaagcccaagactggtcgcaagcaccaattgcgtcgccac
atggcccacttacgtcacccaattgtgggggacacatcgcacggtgatggtaaacacaac
aaattgttccgtaacgaatttgattcacaccgcttgctgttacatgcttcggagctgcgt
tttgtgcatccgtttacaaatgaagagctagtgatgaaagcgagtatcgacgatacgtgg
cagcaattgtttactcgatttgagtgggacgaagagctcgttaagtaa

DBGET integrated database retrieval system