KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_15100Help
Entry
M634_15100        CDS       T02761                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00620  Pyruvate metabolism
vpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M634_15100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpf02000]
    M634_15100
Enzymes [BR:vpf01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     M634_15100
Transporters [BR:vpf02000]
 Other transporters
  Primary active transporters [TC:3]
   M634_15100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: AGQ91700
UniProt: S5IUU3
Position
I:complement(3148836..3150623)
Genome map
AA seq 595 aa AA seqDB search
MSKPLAITDVVLRDAHQSLFATRMRIEDMLPIAAELDKIGYWSLETWGGATFDSCIRFLG
EDPWERLRELKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFDAM
NDVRNFQKAVKSAVDVGAHAQGTLSYTTSPVHNTDTWVDLAKRLEDLGCHSLCIKDMSGL
LKPYEAQELITRIKASCDVPLALHCHATTGLSTATAIKAVEAGIDILDTAISSMSCTYGH
TPTETVVAMLQGTERDTNLKLDQLEPIAAYFREVRKKYAKWEGQLKGVDSRILIAQVPGG
MLTNMEGQLKEQGAADRIDEVLEEIPRVREDLGFIPLVTPTSQIVGTQAVINVLTGERYK
SITKETAGVLKGEYGAAPAAVNADLQAKVLEGKEPITCRPADLLESEMEALTVDLMDKAQ
SEGIKLASERVDDVLTYALFPQVGLKFLKNRGNPDAFEPAPTLESAKPVAAPAAPVASGS
VETYSVRVDGQVYEVEVGPKGQLTSVTPSSASAPVAAPVAPVTANAESVPAPLAGNIFKV
NVQPGAEVAEGDVLLILEAMKMETEVRAARGGIVQELNVKEGDAVTVGAPLLSLA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccactagctattaccgatgtggtccttcgagacgcccatcaatcactgttt
gctacgcgtatgcgtatcgaagatatgctgcctatcgcagctgagttggataagattgga
tactggtccctagaaacctggggtggtgcaacgtttgattcgtgtattcgattccttggg
gaagacccttgggagcgtctacgtgagttgaaaaaggcgatgccaaatacaccaatgcaa
atgctacttcgtggtcaaaaccttttaggatatcgccattatgctgatgacgtagtagag
aagttcgttgagcgtgctcatgccaatggtatggatgtattccgtatctttgatgcgatg
aacgatgttcgcaatttccaaaaagcagtgaaatcggcggtagatgttggcgctcatgcg
caaggcaccctgtcatacacaacaagccctgttcacaatacggatacttgggttgattta
gcaaagcgtttggaagatctcggttgtcattctctgtgtatcaaagacatgtctggcttg
ctaaagccttacgaagcgcaagagctaatcacgcgcatcaaagcctcttgtgatgtacca
ctggcacttcactgccatgctaccactggtctttctaccgctacggcaatcaaagcggta
gaggctggtatcgacatcctcgatacggctatttcttcgatgagctgtacttacgggcat
actccgacagaaacggttgtagcaatgctgcaaggtactgagcgcgacaccaatctgaaa
cttgatcaactagaacctattgcagcctacttccgtgaagtacgtaagaaatacgcgaag
tgggaagggcaactaaaaggcgtggattcccgtatccttatcgctcaagtgccaggtggt
atgttgacgaatatggaaggtcagctaaaagagcaaggtgcagcggatcgtatcgacgag
gtgttagaagaaatcccacgtgtacgtgaagatctcggctttattcctctcgtaacaccg
acgtctcagatcgttggtactcaagccgtcattaacgtactgaccggcgagcgctacaag
agcatcactaaagaaacagctggtgttctcaaaggtgagtacggtgccgctcctgcggca
gtgaatgccgatctacaagctaaagtccttgaaggtaaagagccaattacgtgtcgtcct
gctgatttgttagagtcagaaatggaagcgctcacggtggatttaatggataaggctcag
tctgaaggcattaagcttgcgagtgaacgcgttgatgacgtacttacttatgcgttgttc
cctcaagttggtctgaagttccttaaaaaccgtggtaaccctgacgcttttgaaccagca
cctacattggaaagtgcaaaaccagttgcagcgcctgcggctccagtcgcgtctggtagc
gtagaaacttacagtgttcgcgttgatggacaagtctacgaagttgaagtggggccaaaa
ggacaattgacttctgtgacgccaagttcagcttctgcaccagtggccgctcccgttgct
cctgtgacggcaaatgcggaatcggttcctgcaccgcttgcaggaaacatctttaaagtg
aacgttcagccaggtgctgaagtcgcggaaggtgatgtcctactgatccttgaagcaatg
aagatggaaacggaagttcgtgcagctcgcggtggtatcgttcaagaactgaacgtaaaa
gagggtgatgccgtcaccgttggtgcacctcttctcagtttggcgtaa

DBGET integrated database retrieval system