KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_22980Help
Entry
M634_22980        CDS       T02761                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00260  Glycine, serine and threonine metabolism
vpf01100  Metabolic pathways
vpf01110  Biosynthesis of secondary metabolites
vpf01120  Microbial metabolism in diverse environments
vpf01130  Biosynthesis of antibiotics
vpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M634_22980
Enzymes [BR:vpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     M634_22980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGQ93596
UniProt: S5J977
Position
II:1481552..1482556
Genome map
AA seq 334 aa AA seqDB search
MDFRSDTVTQPTQAMREAMFSAPVGDDVYGDDPTVNELEQFAAELAGFEAALFTTSGTQA
NLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIENNPDGTLPFDKLEAAIK
PDDAHFARTRLLSLENTINGKVIPLSYLAEAREFVNKHNLKLHLDGARVFNAAVALDVPV
KDIGQYFDSMTICLSKGLAAPVGSLLLGSKEYIAKARRLRKMVGGGMRQAGILAATGKLA
ITEQVAQLKQDHINAKALAEGLAELPGFSVNPDFVQTNIVFAKLDAKVDIQSIAEQLKQQ
NIIISPGNPIRFVTHKDISAEDIQTFLSSLKSLL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgttcagacacagtgactcaacccacccaagctatgcgcgaagcaatgttc
agcgcccctgttggcgatgatgtttatggtgacgatcctaccgtaaacgagctagagcag
ttcgcggctgaattagcagggtttgaggcagcgttgtttaccacttctggcacgcaagca
aaccttttaggattaatggcgcattgtgagcgtggcgatgaatatttatgcggccagcaa
gctcacaattacaaatatgaagcaggtggcgcagcggtactgggttctatccagcctcaa
ccaatagaaaacaatccagatggcacgttgccatttgacaaattagaggcagcaattaaa
cctgatgacgcgcactttgctcgtactcgtctgctaagtttagaaaacaccatcaacggt
aaagtgatcccactgtcttacttagcggaagctcgtgaattcgttaataaacacaatctg
aaactgcatctcgacggtgcccgcgtgtttaacgcagctgttgcgctcgatgttcccgtc
aaagatattggtcaatactttgattccatgacgatttgtttatcgaaaggtcttgcggca
cccgttggttcactgctgcttggcagcaaggaatacatcgcgaaagctcgccgtttaaga
aagatggtcggtggcggaatgcgtcaggcaggtattttagcggcaacaggtaaactggcg
atcacggaacaagtcgcgcagttaaagcaagatcacatcaatgcaaaagcattggcggaa
ggtttagctgaactaccgggtttctcggtaaatcctgacttcgttcaaaccaacattgtg
tttgctaagttggatgctaaagtcgatatccaaagcatcgcggagcaactcaagcaacaa
aacatcatcatcagcccaggaaacccaattcgctttgtcacacacaaagacatctctgct
gaagatattcaaaccttcctatcgagccttaaatctctgctttag

DBGET integrated database retrieval system