KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_23065Help
Entry
M634_23065        CDS       T02761                                 

Definition
(GenBank) type VI secretion protein
  KO
K11895  type VI secretion system protein ImpH
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpf02044]
    M634_23065
Secretion system [BR:vpf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M634_23065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AGQ93612
UniProt: S5ITY8
Position
II:complement(1501078..1502043)
Genome map
AA seq 321 aa AA seqDB search
MSSEDFYRELKQRSLFEAIHLIEQELLKVESQIGTDALPKNEKLNLKVNASLGFENAQLV
STKPLGKDKLALETNLIGLTGEQGVLPQHYSELALHRLKEGDHAMVDFYDIFNHRLLSLY
YRSWQLSQLTIQARAHAKNQRSPLIDCMSSLTGDGNDLALHYGGMYASPTRSKGALKSIL
ECLSGCQIRIHEFQGQWMRLSKSEQTRLASKSMPEGQFAQLGAGASLGKRAWNINASTTI
EFLPKERKQVKNLLPKTNTLKTIKQVAGDFIGKHKHVKWQLTTKHSLLPQVQISKQQGQL
GVGSVLKKHERTEDRNITITV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagaggacttctaccgcgagctaaagcaacgttctttgtttgaagctattcat
cttattgagcaagagcttttgaaagttgaatcgcaaattggaacagatgcattacccaaa
aacgagaaactcaacttaaaggtcaatgcatctttaggctttgagaatgcgcaactcgtt
tctactaaaccattaggtaaagataaattagcgcttgagacaaatttgattggcttgacg
ggggagcagggtgtactgcctcagcattacagtgagcttgcattgcatcgactgaaagaa
ggcgatcatgcgatggtggacttctatgacatttttaaccatcggcttttatccctctat
tatcgaagttggcaattgagtcagctaaccatacaagcgcgtgcgcatgcaaaaaatcag
cgctccccattaattgattgcatgtcgtcattgactggcgatgggaatgatcttgcactg
cattatggcggcatgtatgcatctccaacacgaagtaaaggtgcattgaagagcattttg
gaatgtttgtctggttgccaaattcgtattcacgagtttcaaggtcaatggatgcgactg
tctaaatctgaacaaactcgtttggcatcgaaaagtatgcccgaaggccagtttgcacaa
ctcggtgctggtgcgtcactaggaaaaagagcctggaatatcaatgcaagtacaacaatt
gagtttctcccaaaggaaagaaagcaagtcaaaaatctgttacccaagaccaatacattg
aaaacgataaaacaggtagcaggtgacttcattggcaaacacaagcacgttaaatggcaa
ctcacgactaaacatagtctattgcctcaagttcaaatatctaagcaacaaggtcagtta
ggtgtcggctctgtactgaaaaaacatgaacgtacggaagatcgcaacataacaattacg
gtttaa

DBGET integrated database retrieval system