KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_23095
Entry
M634_23095        CDS       T02761                                 

Definition
(GenBank) type VI secretion protein
  KO
K11901  type VI secretion system protein ImpB
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpf02044]
    M634_23095
Secretion system [BR:vpf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M634_23095
SSDB
Motif
Pfam: T6SS_VipA PK SPT16 UPF0228 TFIID_20kDa
Other DBs
NCBI-ProteinID: AGQ93618
UniProt: S5JDR9
Position
II:complement(1508201..1508731)
AA seq 176 aa
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFI
QIDRDNFDDVLKKMSPSVKFKVANKLANDDSEFAVELSFKSMQDFEPAAIVNQVEPLRQL
METRNKLRDLMTKVDRSEELENILEEVLNNTDNLAKLAGELDLGKKAPSESTEGAE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgacgagtatccactcgaaactttcacgagtacggaagcctcgtgttcacattacctac
gatgttgaaaccgaaggaacaactttgaaaaaagagcttccttttgtggtgggtgttatg
ggcgactttgcaggccaaaataccgaagcattgaaaccattaaaggatcgccgtttcatt
caaatcgatcgtgataacttcgatgatgtacttaaaaagatgagtccatcggttaagttc
aaagtcgcaaacaagttagcaaatgacgattctgaatttgcggttgaactgagctttaaa
tcgatgcaagactttgaaccagcagcgattgtcaatcaagtagaaccattgcgtcagctg
atggaaactcgtaacaaactgcgagacttgatgactaaagtcgaccgttcggaagaactt
gaaaacatcctagaagaagttctcaacaatacagacaatttggcaaaactagctggtgag
ctagatcttggcaaaaaagcgccatcagaaagtactgagggagcagaataa

DBGET integrated database retrieval system