KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_23445Help
Entry
M634_23445        CDS       T02761                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00071  Fatty acid degradation
vpf00072  Synthesis and degradation of ketone bodies
vpf00280  Valine, leucine and isoleucine degradation
vpf00310  Lysine degradation
vpf00362  Benzoate degradation
vpf00380  Tryptophan metabolism
vpf00620  Pyruvate metabolism
vpf00630  Glyoxylate and dicarboxylate metabolism
vpf00640  Propanoate metabolism
vpf00650  Butanoate metabolism
vpf00900  Terpenoid backbone biosynthesis
vpf01100  Metabolic pathways
vpf01110  Biosynthesis of secondary metabolites
vpf01120  Microbial metabolism in diverse environments
vpf01130  Biosynthesis of antibiotics
vpf01200  Carbon metabolism
vpf01212  Fatty acid metabolism
vpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M634_23445
   00630 Glyoxylate and dicarboxylate metabolism
    M634_23445
   00640 Propanoate metabolism
    M634_23445
   00650 Butanoate metabolism
    M634_23445
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M634_23445
   00072 Synthesis and degradation of ketone bodies
    M634_23445
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M634_23445
   00310 Lysine degradation
    M634_23445
   00380 Tryptophan metabolism
    M634_23445
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M634_23445
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M634_23445
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M634_23445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpf04147]
    M634_23445
Enzymes [BR:vpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M634_23445
Exosome [BR:vpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M634_23445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Lumazine_bd_2
Motif
Other DBs
NCBI-ProteinID: AGQ93670
UniProt: S5J0B2
Position
II:complement(1581613..1582839)
Genome map
AA seq 408 aa AA seqDB search
MGNDIWIVSAKRTPIGRFQGLLQPYSAPQLGAFAIKAAMKSLGENVLSETVIDEVLMGCV
LPAGCGQAPARQAALGAGFPPSTGCTTINKVCGSGMKSIMLAHDLIKAGTIRTAVAGGME
SMTNAPYLLKEARNGMRLGHHSTYDHMFLDGLQDAYEGHLMGVYAQKIADKLKFSREKMD
EWATMSAKRALEAQERGLFDDEIAPIDIRTKTATTHLDYDEHPRSIDLEKIPQLKPAFDK
KGSVTAANSSAISDGAAALILMDEETARHQNLTPLAIIKSHATHARKPDEFTLAPVYAIE
QLLSQLDWSIDEIDLWEINEAFAVVTQIAVAELGLDSSKVNIKGGACALGHPIGASGARI
LVTLIHSLRQLQALGIDGDASNKKVMRGVASLCIGGGEATAIGIEIPL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgacatttggattgtcagtgcgaaaagaacgccaattgggcgctttcaaggg
ctgttgcaaccgtactccgcaccgcagttaggcgcctttgccataaaagccgcgatgaaa
tcgctgggtgaaaacgtactttctgagactgtaattgatgaagtgttgatgggctgcgta
ctaccagccggatgcggacaagcgccggctagacaggcagcgctcggtgcgggttttcca
cccagtacagggtgcacaaccatcaataaagtttgcggttcgggaatgaaaagcatcatg
cttgctcatgacttgatcaaagctggcaccattcgaacggctgttgctggaggtatggaa
agtatgacgaatgcgccctatttgttgaaagaggcgcgcaatggcatgcgattagggcat
cactccacttacgatcacatgtttctcgatggattgcaggatgcctacgaagggcacttg
atgggcgtctatgctcagaaaattgcagacaagctcaaattcagccgtgagaaaatggat
gagtgggcaaccatgtctgcaaaacgagcgttagaagcgcaagagcgtggtttgtttgat
gatgaaattgcacccattgacatccggacaaaaactgccacaacccatctcgattatgat
gagcatcctcgctccatcgatctagaaaaaattcctcagctcaaacccgctttcgataaa
aaaggctcagtgactgcggcgaactccagtgccatttccgatggcgcggccgcgttgatt
ttgatggatgaagagacggcgcgccaccaaaatcttaccccgcttgccattatcaaatcg
cacgcgactcatgcgagaaagccggatgagtttacgttggctccggtctacgccattgaa
caactgttgtcgcaattggattggtcgattgatgaaattgatctctgggaaatcaacgaa
gcctttgcggtagtgacacaaattgcggttgcggaattagggcttgattcaagcaaggtc
aatattaaaggcggagcttgtgcgctcgggcatccaattggtgccagtggggctcgcatt
ttggtcacattgatccacagtttacgacagctacaagcactggggattgatggggatgca
agcaacaagaaagtgatgcgaggcgttgcgtcactgtgtattggcggtggcgaggcaaca
gcgataggtatcgagatcccgctgtaa

DBGET integrated database retrieval system