KEGG   Vibrio parahaemolyticus O1 Kuk FDA_R31: M634_23490Help
Entry
M634_23490        CDS       T02761                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
vpf  Vibrio parahaemolyticus O1:Kuk FDA_R31
Pathway
vpf00430  Taurine and hypotaurine metabolism
vpf00620  Pyruvate metabolism
vpf00640  Propanoate metabolism
vpf00680  Methane metabolism
vpf01100  Metabolic pathways
vpf01120  Microbial metabolism in diverse environments
vpf01200  Carbon metabolism
Module
vpf_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:vpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M634_23490
   00640 Propanoate metabolism
    M634_23490
  09102 Energy metabolism
   00680 Methane metabolism
    M634_23490
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    M634_23490
Enzymes [BR:vpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     M634_23490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: AGQ93679
UniProt: S5IY43
Position
II:complement(1591511..1592704)
Genome map
AA seq 397 aa AA seqDB search
MSNSFVLVINSGSSSLKFAVIDSVSGDAVLSGLGECFGLSDARMSWKFNGEKKEISIEGD
DSHHKIAIGKLVGLTEELGLAQDIVAVGHRIVHGGEKFTQTVRITEEVTQEIEKLADLAP
LHNPAGAIGIRAAVEAFPSLPQFAVFDTAFHQTMPQRAFTGAIAKELYTDFGIRRYGFHG
TSHYFVSREAAKMINKPIEESSFISVHLGNGASVCAINNGESVDTSMGFTPLSGLMMGTR
CGDLDPGIIEYLLKKGWSQEKVFNSLNKASGFLGVSGLTSDARGILEAMEEGHEGAALAF
QVFTYRVSKYIASYLAALDSFDGIIFTGGIGENSMPIRREILKNLKLLGFVEDVKGNEDA
RFGNAGVIATSELLGAKALVIPTNEEWVIAQQSVELL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattcgtttgtactggtgatcaactctggtagctcttcactaaaatttgcagtc
atcgattccgtatcgggtgacgcggtgctaagtggtctgggcgaatgctttggtctatca
gacgctcgtatgagctggaaattcaacggtgaaaaaaaggaaatctccatcgaaggtgac
gatagccatcacaaaatcgctatcggcaaactagtaggtttaaccgaagagttaggtcta
gctcaagacatcgttgctgtgggccatcgtattgttcacggcggtgagaaattcactcaa
accgttcgtattactgaagaagttacacaagaaattgagaagcttgcagaccttgctcca
cttcacaacccagctggtgctatcggcatccgtgctgctgttgaagcgtttccaagtctt
ccacaatttgcagtattcgatacagcgtttcaccaaacaatgcctcaacgtgcgttcact
ggtgcaatcgctaaagaactttacacagatttcggcattcgtcgttacgggttccacggc
acaagtcattactttgtaagtcgcgaagctgcgaagatgatcaacaagccgattgaagaa
tcgagcttcatctctgttcacttaggtaacggtgcttctgtttgtgcaatcaataatggt
gaatctgtagatacgtctatgggcttcactccgctgtctggtctaatgatgggtacacgt
tgtggtgaccttgacccaggcatcattgagtaccttctgaagaaaggttggtctcaagag
aaagtgttcaactcactgaacaaagcttctggcttcttaggtgtttctggcctaacaagc
gacgcacgcggtattttggaagcaatggaagaaggccacgaaggcgctgcccttgcattc
caagtgttcacataccgtgtgtctaaatacatcgcttcttaccttgctgcgctcgattca
ttcgacggcatcatcttcactggcggtattggcgagaactctatgccaattcgtcgtgaa
attctgaaaaacctaaaactgctaggttttgttgaagatgtgaaaggtaacgaagacgct
cgatttggtaacgcaggtgtgattgctacatctgagttgctaggtgcgaaagcactggtt
attcctaccaacgaagagtgggtaatcgctcaacagtcggtggaactgctgtaa

DBGET integrated database retrieval system