KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_0149Help
Entry
VPUCM_0149        CDS       T03116                                 

Definition
(GenBank) Two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vph00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VPUCM_0149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vph02022]
    VPUCM_0149
Two-component system [BR:vph02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   VPUCM_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AHI98107
Position
1:164468..165187
Genome map
AA seq 239 aa AA seqDB search
MQENHKILVVDDDARLRALLERYLSEQGFQVRSVANGEQMDRLLTRENFHLMVLDLMLPG
EDGLSICRRLRHANNMLPILMLTAKGDEVDRIVGLEVGADDYLPKPFNPRELLARIKAVL
RRQTVELPGAPSTEEKVVEFGEFRLNLGTREMFRGDEAMPLTSGEFAVLKSLVTNAREPM
SRDKLMNMARGREYSAMERSIDVQISRLRRMLEDDPSKPRYIQTVWGLGYVFVPDGKES
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaatcataaaattttagtggttgatgacgatgctcgtttgcgtgctctgttg
gagcgttacctttctgagcaaggttttcaagtccgtagtgtagcaaacggcgaacaaatg
gatcgcctactaacacgcgaaaactttcacttaatggtattggatttgatgttgccaggc
gaagatggcttgtcgatttgtcgccgtttacgccacgccaataacatgttgccaattctg
atgctgacagcaaaaggtgacgaggttgaccgtattgttggtttggaagttggtgcggac
gattacctacctaaaccgttcaacccgcgtgaactactcgctcgtattaaagcggtttta
cgtcgccaaacggttgagctaccgggtgcgccaagtacggaagaaaaagtggtcgagttt
ggcgagtttcgtttgaatctcggcacgcgtgaaatgttccgtggtgatgaggcgatgcca
ttaacatcgggtgaatttgcggtgttgaaatcactggtaaccaacgcgcgtgagccaatg
tcgcgtgataagctgatgaacatggcgcgtggtcgagaatactcggcgatggagcgttct
atcgacgtacaaatttctcgtctacgccgcatgctggaagacgatccgagcaaacctcgc
tacatccagaccgtatggggtttaggttacgtatttgtcccagacggcaaagagtcgtaa

DBGET integrated database retrieval system