KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_0338Help
Entry
VPUCM_0338        CDS       T03116                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00130  Ubiquinone and other terpenoid-quinone biosynthesis
vph00627  Aminobenzoate degradation
vph01100  Metabolic pathways
vph01110  Biosynthesis of secondary metabolites
vph01120  Microbial metabolism in diverse environments
vph01220  Degradation of aromatic compounds
Module
vph_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    VPUCM_0338
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    VPUCM_0338
Enzymes [BR:vph01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     VPUCM_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AHI98296
Position
1:349463..350101
Genome map
AA seq 212 aa AA seqDB search
MHNKIQPSQKKAITLALTGASGAPYGLRLLECLVAADYHVYVLISSAARVVMATEHNLKL
PSGPDAAKQALVEHLNCDPDNITVCGKDDWFSPVASGSAAPKQMVVCPCSAGSVAAIAHG
MSDNLIERAADVVMKERGQLLLVVRETPFSTLHLENMHKLSQMGVTIMPAAPGFYHQPKS
IEDLVDFMVARILDHLGIEQGLVPRWGYDQRS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacaaaatacaaccctctcagaaaaaagccatcacgttggcattaacgggtgcc
tctggtgctccttatggccttcgtcttttagaatgtttggtcgcggcggattatcatgtc
tacgttctgatttcttcggcggctcgcgttgtgatggcaaccgaacacaaccttaagctg
ccaagtgggccagacgccgcaaagcaagcgctggtggaacatctcaactgtgatccagat
aacatcactgtttgtggtaaagatgactggttctcaccggtagcgtctggctcagcggca
ccaaagcaaatggtggtttgcccatgttctgcgggaagcgttgctgcgatcgcgcatggt
atgtcggacaacttgatcgaacgggcggctgatgtggtaatgaaagaacgcgggcaactg
ttgctcgtggttcgtgaaacgccattttcaacgctgcatcttgagaacatgcacaagcta
tcgcaaatgggcgtcaccatcatgccagcggctccgggcttctaccatcagccaaagagc
attgaagacttagtggattttatggtggcgagaattctcgaccacttaggtattgagcaa
ggtttagtgcctcgttggggctatgaccagcgctcgtga

DBGET integrated database retrieval system