KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_0357Help
Entry
VPUCM_0357        CDS       T03116                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
vph  Vibrio parahaemolyticus UCM-V493
Brite
KEGG Orthology (KO) [BR:vph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VPUCM_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AHI98315
Position
1:complement(366689..367069)
Genome map
AA seq 126 aa AA seqDB search
MDVIQPCIKIQVHTKYIEEQSNPELQRFVFAYVITIKNLSQQTVQLISRRWLITDSNGKQ
MTVEGEGVVGQQPFIPSNDEYTYSSGTALETPVGVMQGHYKMLDEKGQEFITEIEPFRLA
IPNVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcattcaaccctgcatcaagattcaagttcacaccaaatacatcgaagagcaa
tccaatccagagctacaacgctttgttttcgcctacgtcattaccattaaaaacctcagc
caacagacagtacagctcataagtcgccgatggttgattaccgattccaacggtaaacaa
atgacggtagagggagaaggtgttgttgggcagcagccgtttattccaagcaacgatgaa
tacacttacagcagtggtaccgcgttagaaacgcctgttggtgtcatgcaaggacactac
aaaatgctggatgaaaaaggccaggaattcatcactgaaattgagccatttcgtttagcg
attccgaacgttttaaattaa

DBGET integrated database retrieval system