KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_20472Help
Entry
VPUCM_20472       CDS       T03116                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00071  Fatty acid degradation
vph00072  Synthesis and degradation of ketone bodies
vph00280  Valine, leucine and isoleucine degradation
vph00310  Lysine degradation
vph00362  Benzoate degradation
vph00380  Tryptophan metabolism
vph00620  Pyruvate metabolism
vph00630  Glyoxylate and dicarboxylate metabolism
vph00640  Propanoate metabolism
vph00650  Butanoate metabolism
vph00900  Terpenoid backbone biosynthesis
vph01100  Metabolic pathways
vph01110  Biosynthesis of secondary metabolites
vph01120  Microbial metabolism in diverse environments
vph01130  Biosynthesis of antibiotics
vph01200  Carbon metabolism
vph01212  Fatty acid metabolism
vph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPUCM_20472
   00630 Glyoxylate and dicarboxylate metabolism
    VPUCM_20472
   00640 Propanoate metabolism
    VPUCM_20472
   00650 Butanoate metabolism
    VPUCM_20472
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VPUCM_20472
   00072 Synthesis and degradation of ketone bodies
    VPUCM_20472
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VPUCM_20472
   00310 Lysine degradation
    VPUCM_20472
   00380 Tryptophan metabolism
    VPUCM_20472
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VPUCM_20472
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VPUCM_20472
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VPUCM_20472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vph04147]
    VPUCM_20472
Enzymes [BR:vph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VPUCM_20472
Exosome [BR:vph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VPUCM_20472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHJ01593
Position
2:477792..479003
Genome map
AA seq 403 aa AA seqDB search
MMEKVFIVAAKRTPIGAFGGSLKNTSAGDLAAVAIKGALEAAKLAGDKVDEVIVGNVVGA
GQGMGVGRQAALFAGIPESVPAYGVNMVCGSGMKTVMDAVSHIRSGDAEIVIAAGVEVMS
QIPFAAPSSIRDGNKMGNLELKDLLVADGLTDVYNQYHMGVTAENVAKEIGLTRQQQDEY
ALSSQQKAVAAIEAGKFKDEIVPVEVQQRRETVLFDTDEYPKANATMEALSKLRPAFDRE
GTVTAGNASGINDGASAIIVASESAVKAHGLTPLAEIVSYAQSGLDPKIMGLGPVESVNK
ALAKAELTVNDIDVYELNEAFAAQALGVIHQLAETNQVPVNAIQDKANFNGGAIALGHPL
GASGNRILVTLVHELHKQNGQYGVASLCVGGGMGTAVVVKAVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaagtatttatcgtagcggcgaagcgtaccccaattggcgcttttggtggc
agcctgaaaaatacctcagctggcgatctggcagcagtagcgattaaaggcgcgttagaa
gcagcaaagttggctggcgacaaggttgacgaagtgattgtcggcaacgttgttggtgca
ggtcaaggcatgggtgttggccgccaagcggcattgtttgctgggattcccgaatctgtt
cctgcatacggcgtaaacatggtttgcggtagtggtatgaaaacggtcatggacgcagtt
tctcatatccgtagtggcgatgcagagatcgttattgcggcgggtgttgaggtcatgtct
cagattccgtttgccgcaccaagcagcattcgtgatggcaacaaaatgggcaatctggag
ctgaaagacctgctcgtagcggacggtttaaccgacgtttacaaccaatatcacatgggt
gtgacggcagaaaacgtagcaaaagaaatcggcctaactcgtcaacagcaagatgaatat
gcgttgtcgagccaacagaaagcggttgccgctattgaagcaggtaaattcaaagacgaa
attgtgccagtggaagtgcaacagcgtcgagaaaccgtactgttcgataccgatgaatac
ccaaaagcgaacgcaacaatggaagctttaagcaagctgcgtcctgcttttgaccgcgaa
ggcacagtgactgcgggtaatgcgtcgggcattaacgatggcgcgagtgcgattatcgtt
gcgtctgaaagcgcagttaaagcgcacggattaacgccgcttgctgagatcgtaagctac
gcgcaatcgggtcttgatccgaagatcatgggcttaggtccagttgagtcggtcaataaa
gcactcgcaaaagcggaactcacagtaaacgacatcgacgtttacgagttaaacgaagca
tttgcagcgcaagcacttggcgtgattcatcagttggcggaaaccaaccaagttccagtt
aatgcgattcaagataaagcgaactttaacggcggtgctatcgcgctaggtcacccgctt
ggtgcatcgggcaaccgaattttagtgacgcttgttcacgagcttcacaagcaaaatggt
caatatggtgttgcttcactttgtgtgggcggcggcatgggcacggctgtggttgtaaaa
gcagttaagtaa

DBGET integrated database retrieval system