KEGG   Vibrio parahaemolyticus UCM-V493: VPUCM_2630Help
Entry
VPUCM_2630        CDS       T03116                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vph  Vibrio parahaemolyticus UCM-V493
Pathway
vph00620  Pyruvate metabolism
vph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPUCM_2630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vph02000]
    VPUCM_2630
Enzymes [BR:vph01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     VPUCM_2630
Transporters [BR:vph02000]
 Other transporters
  Primary active transporters [TC:3]
   VPUCM_2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: AHJ00589
Position
1:complement(2846849..2848636)
Genome map
AA seq 595 aa AA seqDB search
MSKPLAITDVVLRDAHQSLFATRMRIEDMLPIAAELDKIGYWSLETWGGATFDSCIRFLG
EDPWERLRELKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFDAM
NDVRNFQKAVKSAVDVGAHAQGTLSYTTSPVHNTDTWVDLAKRLEDLGCHSLCIKDMSGL
LKPYEAQELITRIKASCDVPLALHCHATTGLSTATAIKAVEAGIDILDTAISSMSCTYGH
TPTETVVAMLQGTERDTNLKLDQLEPIAAYFREVRKKYAKWEGQLKGVDSRILIAQVPGG
MLTNMEGQLKEQGAADRIDEVLEEIPRVREDLGFIPLVTPTSQIVGTQAVINVLTGERYK
SITKETAGVLKGEYGAAPAAVNADLQAKVLEGKDPITCRPADLLESEMEALTVDLMDKAQ
SEGIKLASERVDDVLTYALFPQVGLKFLKNRGNPDAFEPAPTLESAKPVAAPAAPVASGS
VETYSVRVDGQVYEVEVGPKGQLTSVTPSSASAPVAAPVAPVTANAESVPAPLAGNIFKV
NVQPGAEVAEGDVLLILEAMKMETEVRAARGGIVQELNVKEGDAVTVGAPLLSLA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccactagctattaccgatgtggtccttcgagacgcccatcaatcactgttt
gctacgcgtatgcgtatcgaagatatgctgcctatcgcagctgagttggataagattgga
tactggtccctagaaacctggggtggtgcaacgtttgattcgtgtattcgattccttggg
gaagacccttgggagcgtctacgtgagttgaaaaaggcgatgccaaatacaccaatgcaa
atgctacttcgtggtcaaaaccttttaggatatcgccattatgctgatgacgtagtagag
aagttcgttgagcgtgctcatgccaacggtatggatgtattccgtatctttgatgcgatg
aacgatgttcgcaatttccaaaaagcggtgaaatcggcggtagatgttggcgctcatgcg
caaggcaccctgtcatacacaacaagccctgttcacaatacggatacttgggttgattta
gcaaagcgtttggaagatctcggttgtcattctctgtgtatcaaagacatgtctggcttg
ctaaagccttacgaagcgcaagagctaatcacacgcatcaaagcctcttgtgatgtacca
ctggcactccactgccatgcaaccactggtctttctaccgctacggcaatcaaagcggta
gaggctggtatcgacatcctcgatacggctatttcttcgatgagctgtacttacgggcat
accccgacagaaacggttgtagcaatgctgcaaggtactgagcgcgacaccaacctgaaa
cttgatcaactagaacctattgcagcttacttccgtgaagtacgtaagaaatacgcgaag
tgggaagggcaactaaaaggcgtggattcccgtatccttattgctcaagtgccaggtggt
atgttgacgaatatggaaggtcagctaaaagagcaaggtgcagcggatcgtatcgacgag
gtgttagaagaaatcccacgtgtacgtgaagatcttggctttattcctctcgtaacaccg
acgtctcagatcgttggtactcaagccgtcattaacgtactgaccggcgagcgctacaag
agcatcactaaagaaaccgctggtgttctcaaaggtgagtacggtgccgctcctgcggca
gtgaatgccgatctacaagctaaagtccttgaaggtaaagatccaattacgtgtcgtcct
gctgatttgttagagtcagaaatggaagctctcacggtggatttaatggataaggctcaa
tctgaaggcattaagcttgcgagtgaacgcgttgatgacgtacttacttatgcgttgttc
cctcaagttggtctgaagttccttaaaaaccgtggtaaccctgatgcttttgaaccagca
cctacattggaaagtgcaaaaccagttgcagcgcctgcggctcctgtcgcgtctggtagc
gtagaaacttacagtgttcgcgttgatggacaagtctacgaagttgaagtggggccaaaa
gggcaattgacttctgtgacgccaagttcagcttctgcaccagtggccgctcccgttgct
cctgtgacggcaaatgcggaatcggttcctgcaccgcttgcaggaaacatctttaaagtg
aacgttcagccgggtgctgaagtcgcagaaggtgatgtcctactgatccttgaagcaatg
aagatggaaacggaagttcgtgcagctcgcggtggtatcgttcaagaactgaacgtaaaa
gagggggatgccgttaccgttggtgcacctcttctcagtttggcgtaa

DBGET integrated database retrieval system