KEGG   Vagococcus penaei: BW732_02095Help
Entry
BW732_02095       CDS       T04715                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
vpi  Vagococcus penaei
Pathway
vpi00010  Glycolysis / Gluconeogenesis
vpi00030  Pentose phosphate pathway
vpi00051  Fructose and mannose metabolism
vpi00680  Methane metabolism
vpi01100  Metabolic pathways
vpi01110  Biosynthesis of secondary metabolites
vpi01120  Microbial metabolism in diverse environments
vpi01130  Biosynthesis of antibiotics
vpi01200  Carbon metabolism
Module
vpi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BW732_02095
   00030 Pentose phosphate pathway
    BW732_02095
   00051 Fructose and mannose metabolism
    BW732_02095
  09102 Energy metabolism
   00680 Methane metabolism
    BW732_02095
Enzymes [BR:vpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BW732_02095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AQP53138
UniProt: A0A1Q2D446
Position
441099..443012
Genome map
AA seq 637 aa AA seqDB search
MKKDKYYELLKKQYPTKNDIVSEIINLKAILNLPKGTEHFVSDIHGEYRAFQHILRNGSG
NIKAKIHDLFKGELSDVAQGELATLVYYPEKILDMNQYDDDWYKVKIDQLVRLTHFSSSK
YTRSKLRKSIPKRFSYIIQELLYQSMSSEDKADYYEQIIQTIIDLGQADAIIIDLSYMIQ
KLVVDHLHVVGDIYDRGPEPDKIIEELIHHHSVDIQWGNHDIIWMGAAAGSPICMMNTIR
ISARYNNLDIIEDVYGINLRPLLTYAEKYYEDNPAFRPKLSGECQVSEEELLETTKIHQA
AAVLQFKLEERLVKRRPEFKMEHRQLLSRTNFDTMEVEIKGQTYPLTNTCFTTVNPDNVE
ELTVEEFDVIQRLLKNFINSEKLKRHIDFLFEKGNMYLVYNDNLLVHGCIPLKEDGSFKA
FPVDGIHYAGKELLDLFEYSLRKAYKQPDVMNDFDTDLIWYLWSGECSSLFGKKEMTTFE
RYFIEDKETHLEPKNPYYALRENPEIIHRILNEFGLNSPDSHLISGHTPVKEIKGENPIK
ANGKMLVIDGGFSKPYQKTTGLAGYTLLYNSYGMQLAAHKSFSTIDTIFTDHDDVISVRR
VVDKPLKRKKVRDTTIGRQLLEEIRDLENLLAYENRR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggataagtattatgagttactaaaaaaacaatatccaacgaaaaatgatatt
gtaagcgaaatcattaatttgaaagcgattttaaatttaccgaaagggacggagcatttt
gttagtgacattcatggggaatatcgggcctttcagcacattttgcggaatggttctggt
aatatcaaagcaaaaattcacgatttatttaaaggtgaattgagtgatgttgctcaaggc
gagctggcaactttagtgtactatcctgaaaaaatactggatatgaaccaatatgatgat
gactggtacaaagtaaaaatcgaccaacttgttcgtctaactcatttttcatcttcaaaa
tatacgcgttctaagttgcgtaaatcaattccaaaacgcttttcttatattattcaagaa
ttactttatcaaagcatgagttctgaagataaagcagattattatgaacaaatcatccaa
acaatcattgatttaggacaagcagatgcaattattattgatttaagttatatgattcaa
aaattagtagttgatcatttacatgttgtaggcgatatctatgaccgtggaccagaaccg
gataaaatcattgaagaactgattcatcatcactcagtggatattcaatggggaaaccat
gatattatctggatgggagcagccgctgggtcacctatttgtatgatgaatacgattcga
atttctgctcgctataataaccttgacattattgaagacgtttatggaattaatctacgt
ccattgctaacctacgcagaaaaatattatgaagataacccagcctttcgccctaaatta
agtggcgagtgtcaggttagtgaagaagagttacttgaaaccacaaaaattcatcaagct
gcagctgttttacaatttaaactagaggagcgtttggttaaacgtcgcccagaatttaaa
atggagcacagacaattactgagccggactaactttgatacaatggaagttgagattaaa
gggcaaacctatccgctaacaaatacttgttttacaacagttaatcctgacaatgtggaa
gaattaactgttgaagaatttgacgtgattcaacgcttactaaaaaactttattaattcg
gaaaaattaaaacgtcacatcgactttttatttgaaaaaggcaatatgtatctcgtctat
aatgataatttactggtacatggctgtattccattgaaagaggatggtagttttaaagcc
ttcccagttgatggcattcattacgctggtaaagagctcttagacttatttgaatattca
ctacgtaaagcctataaacagcccgatgtcatgaatgattttgacaccgatttaatttgg
tatttatggtctggcgaatgttcatctttatttggtaagaaagaaatgactactttcgag
cgttactttattgaagacaaagaaacccatctcgaaccaaaaaatccttattatgcttta
cgtgaaaatcctgagattattcatcgtattttaaatgagttcggtttaaatagtcccgat
agtcacttgattagtggccatactcctgtcaaagaaattaaaggtgaaaatccaattaaa
gctaatgggaaaatgcttgtaattgatggtggcttttctaaaccatatcaaaaaacaact
ggtctagctggttacactctgctctataattcatatgggatgcaactagcagcgcataag
tcattttcaactattgatacaatttttactgatcatgatgatgtaatttctgttcgccgt
gtggttgacaagccacttaaacgaaaaaaagtccgtgataccactattgggcgtcagcta
ctagaagaaattcgtgatttagagaatttacttgcctacgaaaatagacgctaa

DBGET integrated database retrieval system