KEGG   Vagococcus penaei: BW732_03255Help
Entry
BW732_03255       CDS       T04715                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vpi  Vagococcus penaei
Pathway
vpi00010  Glycolysis / Gluconeogenesis
vpi00020  Citrate cycle (TCA cycle)
vpi00620  Pyruvate metabolism
vpi01100  Metabolic pathways
vpi01110  Biosynthesis of secondary metabolites
vpi01120  Microbial metabolism in diverse environments
vpi01130  Biosynthesis of antibiotics
vpi01200  Carbon metabolism
Module
vpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BW732_03255
   00020 Citrate cycle (TCA cycle)
    BW732_03255
   00620 Pyruvate metabolism
    BW732_03255
Enzymes [BR:vpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BW732_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RuvB_N GCV_H HlyD_D23 Biotin_lipoyl_2 PYNP_C
Motif
Other DBs
NCBI-ProteinID: AQP53347
UniProt: A0A1Q2D564
Position
complement(674577..675794)
Genome map
AA seq 405 aa AA seqDB search
MAEMLMMPTLGLTMTEGTVDQWYKKVGDKVSKGEPVVAISSEKLTHDVEAPCDGILLAIS
VEDGGEAPCKAAIGYVGAEGEEVPKSDGVTETTSEKVKTESQVEPSATNTEVQIQSVERQ
EGARIFATPLARKLAAEKGYELQDVVGTGGNGRITRLDVNRHVPSPAVVNSGIVGTIGEG
LNGMRKVIAQRMHHSLHHTAQLTLQRKADITELMTFRKELKVKAGDSLNRQALSINTLLI
KAVSLALQDYPEMNAWYDGQQHTLVEGVSVGVAVAVDDGLVVPVIQNVHQKSLTQIGSDF
SEVTSQAIDGTLAGDKYTGSTFTITNLGSLGIEYFTPILNTPEVGILGIGATSRRLDIDE
EQQLVIHQELPLSLTFDHQVIDGSPAAEFLQRVVYYLENPYALIV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatgttaatgatgccaactttaggcttaaccatgacggaaggaaccgttgat
caatggtataaaaaagttggagataaagtcagtaaaggtgaaccagttgttgcaattagt
tcagaaaaattaacacacgacgtagaagcgccatgtgatggaattttgttagcgattagt
gttgaagacggcggcgaagcgccatgtaaagcagcaattggttatgttggagcagaaggt
gaagaagtacctaaaagtgacggcgtaacagaaacgacatcagaaaaagtgaagactgaa
agtcaagtagagccatcagctacgaatacagaagtacaaattcagagtgtggaacgccaa
gaaggtgcgcggatttttgctacgccacttgcacggaaattagcagctgaaaaaggttat
gaattacaagatgttgttggaactggagggaatggtcgcattacacgtttagatgttaac
cgtcatgtaccgagtcctgcagtagttaatagtggtatagtgggtacaattggtgaagga
ttaaatggtatgagaaaagtcattgcgcaaagaatgcaccatagcttacaccatacagca
caattaaccttacaacgcaaagctgacatcaccgagttaatgacgttcagaaaagaatta
aaagtaaaagctggagatagtctaaaccgtcaggcgttaagtattaatacattattaatt
aaagctgtcagtttggcgctacaagattatcctgaaatgaacgcgtggtatgatggtcag
cagcatactttagttgaaggtgttagtgttggagtagcagttgccgtagatgatggatta
gtggtacctgtgattcaaaatgttcatcaaaaatcattgacacaaattgggtcagatttt
agcgaggtaacatcacaagcaattgatggtacattagctggagataagtacacaggttct
acatttacaattactaatttaggtagtttaggcattgaatactttacgcctatcttaaat
acgccagaagtaggtattttaggcataggcgcaactagtcgacgtcttgatatagatgaa
gaacagcagttagttattcaccaagaattaccattaagtttgacatttgatcaccaagtg
attgatggttctcctgctgctgaatttttacagcgagtggtctattatttagaaaatcca
tatgctctaatcgtataa

DBGET integrated database retrieval system