KEGG   Vagococcus penaei: BW732_10160Help
Entry
BW732_10160       CDS       T04715                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vpi  Vagococcus penaei
Pathway
vpi00620  Pyruvate metabolism
vpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW732_10160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpi02000]
    BW732_10160
Enzymes [BR:vpi01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BW732_10160
Transporters [BR:vpi02000]
 Other transporters
  Primary active transporters [TC:3]
   BW732_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like SLED
Motif
Other DBs
NCBI-ProteinID: AQP54532
UniProt: A0A1Q2D836
Position
2115383..2116777
Genome map
AA seq 464 aa AA seqDB search
MTKKIQFMETVLRDGQQSLIATRMPTADMLPIIKTMDEAGYHSLEMWGGATFDSCIRFLN
EDPWERLRKIRAEVKNTKLQMLLRGQNLLGYKNYSDDVVREFVEKSIKNGIDIIRVFDAL
NDTRNLQTSIITAKEAGGHCQAAISYTTSKIHTVDYFVALAKEMANTGADSICIKDMAGI
LTPQTGFELVSRIKDAIDLPLEVHTHATSGISEMTYLRVAEAGADIIDTAISSFAGGTSQ
PATESVAMALEEMGYDTGLNMEKLTEIAEYFNPIRDTFRNDGILNPKVKDIEPKTLIYQV
PGGMLSNLLSQLTEQGLQDKYDEVLAEVPKVRADLGFPPLVTPLSQMVGTQALMNVISGE
RYKLVPTEIKDYVKGLYGRPPVEISKEIQEKIIGDAEVITQRPADLIAPQMPAFREEIKQ
YAKSEEDVLMYALFPQQATDFLGRREDPFYDVPVQHVDVKIDLS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaattcagtttatggaaacagttttgcgtgatgggcaacaaagtttaatt
gccacaagaatgccaacagcagatatgttaccaattattaaaacaatggacgaagctggc
tatcattcgttagaaatgtggggcggagcaacgtttgattcttgtattcgtttcttaaat
gaagatccgtgggaaagattacggaaaattcgtgcagaagttaaaaatactaagctacaa
atgttattacgtggccaaaatttattaggttataaaaattattccgatgatgtagtacgt
gaatttgtcgaaaaatcaatcaaaaatgggattgatatcattcgcgtatttgacgcgtta
aatgatacgcgtaatcttcaaacatcaatcattacagcaaaagaagctggtggtcattgc
caagcagccatctcttatacaacaagtaagattcatacagttgactattttgtggcatta
gccaaagaaatggctaatactggagcagattcaatctgtattaaagatatggctggaatt
ttaacaccacaaactggtttcgaattagtgagtcgaattaaagatgcaattgatttaccg
ttagaagtccatacgcacgcaacaagtgggatttcagagatgacatatttacgggttgct
gaagcaggtgctgatattattgatactgccatctcatcatttgctggtggtacaagtcaa
ccagcaacagaatcggttgctatggcattagaagaaatgggttatgatactggattaaat
atggaaaaattaacagaaattgctgaatactttaatccaattcgtgacacctttagaaat
gatggtatattaaatccaaaagtaaaagatattgaaccgaaaacattaatttatcaagta
cctggtgggatgttatctaacttattaagccagttgacagaacagggattacaagacaaa
tatgatgaagttttagcggaagttcctaaggtacgtgctgatttaggatttccaccactt
gttacgccattatcacaaatggtgggtacacaagcattaatgaacgttatttcaggtgaa
cgatataaattagtcccaacagaaattaaagattatgttaaaggcttatatggtcgtcca
ccagttgaaatttcaaaagagattcaagaaaaaattattggagatgctgaggtaatcacg
caacgtccagcagatttaatcgcaccacaaatgcctgcttttagagaggaaatcaagcag
tatgcgaaatcagaggaagatgtcttgatgtacgcgttattcccgcaacaagcaacagat
ttcttaggtcgtcgtgaagacccattctacgatgtacctgtgcaacatgttgatgtcaag
attgacttatcataa

DBGET integrated database retrieval system