KEGG   Vagococcus penaei: BW732_10930Help
Entry
BW732_10930       CDS       T04715                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpi  Vagococcus penaei
Pathway
vpi00071  Fatty acid degradation
vpi00072  Synthesis and degradation of ketone bodies
vpi00280  Valine, leucine and isoleucine degradation
vpi00310  Lysine degradation
vpi00362  Benzoate degradation
vpi00380  Tryptophan metabolism
vpi00620  Pyruvate metabolism
vpi00630  Glyoxylate and dicarboxylate metabolism
vpi00640  Propanoate metabolism
vpi00650  Butanoate metabolism
vpi00900  Terpenoid backbone biosynthesis
vpi01100  Metabolic pathways
vpi01110  Biosynthesis of secondary metabolites
vpi01120  Microbial metabolism in diverse environments
vpi01130  Biosynthesis of antibiotics
vpi01200  Carbon metabolism
vpi01212  Fatty acid metabolism
vpi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW732_10930
   00630 Glyoxylate and dicarboxylate metabolism
    BW732_10930
   00640 Propanoate metabolism
    BW732_10930
   00650 Butanoate metabolism
    BW732_10930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW732_10930
   00072 Synthesis and degradation of ketone bodies
    BW732_10930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW732_10930
   00310 Lysine degradation
    BW732_10930
   00380 Tryptophan metabolism
    BW732_10930
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BW732_10930
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BW732_10930
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BW732_10930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpi04147]
    BW732_10930
Enzymes [BR:vpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BW732_10930
Exosome [BR:vpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BW732_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQP54669
UniProt: A0A1Q2D8D9
Position
2272361..2273542
Genome map
AA seq 393 aa AA seqDB search
MKEVVIVAARRSPIGSFGGSLKNINAVELGQKVVVETLKDINLDPAEVDEVILGNVLSGG
LGQNVSRQIAINAGIPQDASAFTINKVCGSGLKSVILGAQSIMLGDNEVVVVGGSESMSQ
APYVLPTARYGQRMGDGKIVDTMLSDGLTDAFHGIHMGITAENIAEKYGFTREAQDEFAA
KSQNKAEKAIKEGRFKDEIVPIEIPQRKGEPVIFAQDEFPRFGSTAESLGKLRPAFKKDG
TVTAGNASGINDGAAILVLMTREKAEKLGLEVLASVVSYASAGVDPLIMGTGPISATKKA
LAKAEMSVDDLELVESNEAFAAQAMSVAQELNLNEDITNVNGGAISLGHPIGASGARILV
SLIHEMKKRDAKKGLATLCIGGGQGISLVIKRD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaagtagtcattgtagcagcaagaagaagtccaattggttcttttggaggcagc
ttgaaaaatataaatgccgtagaattaggccaaaaagttgttgtagaaacattaaaggat
attaacttagatccagctgaagttgatgaagttatcttaggtaatgttttatctggtggt
cttggacaaaatgtttcaagacaaattgctatcaacgctggtatccctcaagatgcttca
gcatttacaattaataaagtttgtgggtctggtttgaaatcagttatcctaggtgctcaa
tcaattatgttgggtgataatgaagtagtagttgttggtggttctgaaagtatgagtcaa
gcaccatacgtattaccaactgcacgttacggacaacgtatgggtgatggtaaaatcgtt
gatactatgttatctgatggtctgactgatgctttccacggtattcatatgggaattaca
gctgagaacattgctgaaaaatatggtttcacacgcgaagctcaagatgagtttgcggct
aagagccaaaacaaagcagaaaaagctatcaaagaaggtcgcttcaaagatgaaattgta
ccaattgagattccacaacgtaaaggtgaaccagttattttcgctcaagatgagtttcca
agatttggttcaactgctgaatctttaggtaaattacgtcctgcatttaaaaaagatggt
acagtaactgctggtaatgcatctggaattaatgatggcgcagctattttagttttaatg
actcgcgaaaaagcagaaaaattaggcttagaagtcttagcatctgttgtatcttatgct
tctgctggtgttgatccattaatcatgggtactggaccaattagcgcaactaaaaaagcg
ctagctaaagctgagatgagtgtagatgatttagaattagttgagtcaaatgaagctttc
gctgctcaagcaatgagtgtagcacaagaattaaacttaaatgaagacattacaaacgtt
aatggtggtgcaatttctctaggtcatccaatcggagcaagtggtgcacgtattttagta
tcattaatccatgaaatgaaaaaacgtgatgctaaaaaaggtctagcaactctatgtatt
ggtggcggacaaggaatttctttagtaattaaaagagattaa

DBGET integrated database retrieval system