KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_04530
Entry
M636_04530        CDS       T02760                                 

Definition
(GenBank) hemolysin D
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    M636_04530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpk02044]
    M636_04530
Secretion system [BR:vpk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M636_04530
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGQ96577
Position
II:complement(996100..996579)
AA seq 159 aa
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTI
TKLQDRSSPDLFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPV
ETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcagtctaatacgtatcttaaatacgcagatattaaaggtgaagcgacagcggaacaa
tataaggatttaattacactactatctgtagattggagtgttggtcgtgaaatttcttct
tacacgggtacagcaatggaccgtgaagcaagtgcaacacgcctatatgatttaactatc
actaaacttcaagatcgttcgtctcctgatctattcaaggaagcaacaatcggtaaaggt
aaacctgcagtattccacatcactaagcagggtgaaaaagttgaagaaatcatgaaaatc
gaactgactgatgcgatgatttctaactactcagtatcgattcaagatgatcgcccagta
gaaactatcacaatttcatacactgaaatgatgatgacagtgacacctactgatgacaaa
aacaacacttctgctccgttggtttacggttacagcggtgttaaaggtcaacaaatgtaa

DBGET integrated database retrieval system