KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_04565
Entry
M636_04565        CDS       T02760                                 

Definition
(GenBank) EvpB family type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpk02044]
    M636_04565
Secretion system [BR:vpk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M636_04565
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AGQ96584
Position
II:complement(1004993..1006486)
AA seq 497 aa
MTTQVEKQLDPTVGEQTTSFLEQAIGATKQTEASRAEELIKTLTEEAMKGTVSWNKNLTV
TFREAINLLDRQISEQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKIRMISITKKE
LHKDLSKAVEFDQSQIFKKVYESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAA
SGFSPFLSAASPALFGFDEWTELSKPRDLDKVFESLEYAQWRSFRESADSRFVSLTMPKV
LARLPYGQATSPVEAFGFEEFDVDPVSGIAVNADHNDYCWMNSSYVLGVKLTDAFSKYGF
CTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLGFLPLCHYKNT
NYAVFFGAQTCQKPANHESPEVAANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGSPGSYNAVAWLKPWLQME
ELTTSLRLVAKIPQSGG
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacgactcaagttgaaaaacaactcgatcctacggtgggtgaacaaaccacttcattt
cttgaacaggctattggtgcgacgaaacaaacagaagcatcgagagcagaagagctgatc
aagacactgactgaagaagctatgaaggggacggtttcttggaataaaaacctaaccgta
actttccgtgaagcgattaatttgcttgatagacagatttcagagcagctttctgaagtt
atgcaccatcctgagctacaaaagttagaaggctcatggcgtgggctgaattacttagtc
atgaattctgagacaagttctacgctgaaaattcgcatgatcagcatcacgaagaaagag
cttcataaagacttaagtaaagcggttgaattcgatcaaagtcaaatctttaaaaaagtg
tacgaatctgaatttggtagcgctggtggtgaaccgtatggtgctttaattggtgactac
gagtttacaaaccatccagaagatattgagtctttgcgtttaatgtcgaatgttgctgct
tcgggtttctcaccattcttgtctgctgcttctcctgcgctatttggttttgatgagtgg
acagaactatctaaaccgcgcgatttagataaagtctttgagtcgttggaatatgcgcaa
tggcgctctttccgtgaaagtgcagattctcgttttgtaagcttaacgatgcctaaagta
ttagcccgcctaccatacggccaagctacgtctcctgtagaagcgtttggctttgaagag
tttgatgtggatcctgtgtcgggtatcgccgttaatgctgatcacaatgattattgttgg
atgaactcatcgtacgtgcttggcgtcaaactgacggatgcattttctaagtatggtttc
tgtactgctattcgtggcgcagagggtggtggtcgagttgataacctaccaacacacttc
ttcatgagtgatgatggtgatccagatatgaagtgcccaacggaaattggcattacagac
cgccgtgaagcggaattgggtaaactgggtttcttaccgttgtgtcactacaaaaataca
aactatgccgtgttctttggtgctcaaacttgtcaaaaaccagcaaatcatgaatctcca
gaagtggcagcaaacgcggcaatttcagcaagacttccttacatgatggcaacctctcgt
tttgcacattatttgaaagtaatggctcgagacaagatcggtagctttatggaagcagaa
gacgttgaatcttggttgaaccgttggattcttggctatgtgaacgcttctgaaggtggc
ggtcaagaaattcgtgcgaaataccctcttgccgacgctcgcgtacaagttaaggagatt
ccaggttctcctggttcttacaacgcggttgcttggctcaaaccatggcttcaaatggaa
gagctaaccacgtctttaagactcgttgctaaaattcctcagtcgggtggctaa

DBGET integrated database retrieval system