KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_04570
Entry
M636_04570        CDS       T02760                                 

Definition
(GenBank) type VI secretion protein
  KO
K11901  type VI secretion system protein ImpB
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpk02044]
    M636_04570
Secretion system [BR:vpk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M636_04570
SSDB
Motif
Pfam: T6SS_VipA PK SPT16 UPF0228 TFIID_20kDa
Other DBs
NCBI-ProteinID: AGQ96585
Position
II:complement(1006486..1007016)
AA seq 176 aa
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFI
QIDRDNFDDVLKKMSPSVKFKVANKLANDDSEFAVELSFKSMQDFEPAAIVNQVEPLRQL
METRNKLRDLMTKVDRSEELENILEEVLNNTDNLAKLAGELDLGKKAPSESTEGAE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgacgagtatccactcgaaactttcacgagtacggaagcctcgtgttcacattacctac
gatgttgaaaccgaaggaacaactttgaaaaaagagcttccttttgtggtgggtgttatg
ggcgactttgcaggccaaaataccgaagcattgaaaccattaaaggatcgccgtttcatt
caaatcgatcgtgataacttcgatgatgtacttaaaaagatgagtccatcggttaagttc
aaagtcgcaaacaagttagcaaatgacgattctgaatttgcggttgaactgagctttaaa
tcgatgcaagactttgaaccagcagcgattgtcaatcaagtagaaccattgcgtcagctg
atggaaactcgtaacaaactgcgagacttgatgactaaagtcgaccgttcggaagaactt
gaaaacatcctagaagaagttctcaacaatacagacaatttggcaaaactagctggtgag
ctagatcttggcaaaaaagcgccatcagaaagtactgagggagcagaataa

DBGET integrated database retrieval system