KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_05415Help
Entry
M636_05415        CDS       T02760                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk00071  Fatty acid degradation
vpk00072  Synthesis and degradation of ketone bodies
vpk00280  Valine, leucine and isoleucine degradation
vpk00310  Lysine degradation
vpk00362  Benzoate degradation
vpk00380  Tryptophan metabolism
vpk00620  Pyruvate metabolism
vpk00630  Glyoxylate and dicarboxylate metabolism
vpk00640  Propanoate metabolism
vpk00650  Butanoate metabolism
vpk00900  Terpenoid backbone biosynthesis
vpk01100  Metabolic pathways
vpk01110  Biosynthesis of secondary metabolites
vpk01120  Microbial metabolism in diverse environments
vpk01130  Biosynthesis of antibiotics
vpk01200  Carbon metabolism
vpk01212  Fatty acid metabolism
vpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vpk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M636_05415
   00630 Glyoxylate and dicarboxylate metabolism
    M636_05415
   00640 Propanoate metabolism
    M636_05415
   00650 Butanoate metabolism
    M636_05415
  Lipid metabolism
   00071 Fatty acid degradation
    M636_05415
   00072 Synthesis and degradation of ketone bodies
    M636_05415
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M636_05415
   00310 Lysine degradation
    M636_05415
   00380 Tryptophan metabolism
    M636_05415
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M636_05415
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M636_05415
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M636_05415
Enzymes [BR:vpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M636_05415
Exosome [BR:vpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M636_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGQ96722
Position
II:complement(1192797..1194008)
Genome map
AA seq 403 aa AA seqDB search
MMEKVFIVAAKRTPIGAFGGSLKNTSAGDLAAVAIKGALEAAKLAGDKVDEVIVGNVVGA
GQGMGVGRQAALFAGIPESVPAYGVNMVCGSGMKTVMDAVSHIRSGDAEIVVAAGVEVMS
QIPFAAPSSIRDGNKMGNLELKDLLVADGLTDVYNQYHMGVTAENVAKEIGLTRQQQDEY
ALSSQQKAVAAIEAGKFKDEIVPVEVQQRRETVLFDTDEYPKANATMEALSKLRPAFDRE
GTVTAGNASGINDGASAIIVASESAVKAHGLTPLAEIVSYAQSGLDPKIMGLGPVESVNK
ALAKAELTVNDIDVYELNEAFAAQALGVIHQLAETNQVPVNAIQDKANFNGGAIALGHPL
GASGNRILVTLVHELHKQNGQYGVASLCVGGGMGTAVVVKAVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaagtatttatcgtagcggcgaagcgtaccccaatcggcgcttttggtggc
agcctgaaaaatacctcagctggcgatctggcagcagtagcgattaagggcgcgttagaa
gcagcaaagttggctggcgacaaggttgacgaagtgattgtcggcaacgttgttggtgca
ggtcaaggcatgggtgttggccgccaagccgcattgtttgctgggattcctgaatctgtt
cctgcatatggcgtaaacatggtttgtggtagtggtatgaaaacggtcatggacgcagtt
tctcatatccgtagtggcgatgcagagatcgttgttgcagcgggtgttgaggtcatgtct
cagattccgtttgccgcaccaagcagcattcgtgatggcaataaaatgggcaatctggag
ctgaaagatctgctcgtagcggacggtttaaccgacgtttacaaccaatatcacatgggt
gtgacggcagaaaacgtagcaaaagaaatcggcctaactcgtcaacagcaagacgaatat
gcgttgtcgagccaacagaaagcggttgccgctattgaagcaggtaaattcaaagacgaa
attgtgccagtggaagtgcaacagcgtcgagaaaccgtactattcgataccgatgaatac
ccaaaagcgaacgcaacaatggaagctttaagcaagctgcgtcctgcttttgaccgcgaa
ggcacagtgactgcgggtaatgcgtcgggcattaacgatggcgcgagtgcgattatcgtt
gcgtctgaaagcgcagttaaagcgcacggattaacgccgcttgctgagatcgtaagctac
gcgcaatcgggtcttgatccgaaaatcatgggcttaggtccagttgagtcggtcaataaa
gcactcgcaaaagcagaactcacagtaaacgacatcgacgtttacgagttaaacgaagca
tttgcagcgcaagcacttggcgtgattcatcagttggcggaaaccaaccaagttccagtt
aatgcgattcaagataaagcgaactttaacggcggtgctatcgcgctaggccacccgctt
ggtgcatcgggcaaccgaattttagtgacgcttgttcacgagcttcataagcaaaatggt
caatatggtgttgcttcactttgtgtgggcggcggcatgggcacggctgtggttgtaaaa
gcagttaagtaa

DBGET integrated database retrieval system