KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_13395Help
Entry
M636_13395        CDS       T02760                                 

Definition
(GenBank) sensor histidine kinase
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk02020  Two-component system
vpk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M636_13395
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M636_13395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vpk01001]
    M636_13395
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vpk02022]
    M636_13395
Enzymes [BR:vpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     M636_13395
Protein kinases [BR:vpk01001]
 Histidine kinases
  OmpR family
   M636_13395
Two-component system [BR:vpk02022]
 OmpR family
  QseC-QseB (quorum sensing)
   M636_13395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HATPase_c_5 HATPase_c_2 TarH
Motif
Other DBs
NCBI-ProteinID: AGQ98246
Position
I:complement(1067873..1069303)
Genome map
AA seq 476 aa AA seqDB search
MVWGTFLKNKKPYSIKRQLTLSVGLLVSALLLISLYFSFQSAKHEVEEVYDARLGQSAKL
MLLTLSISTETDTLANHRELFDQWMKNIDSLAKSDEDKATKFGHPYEQNLVFQFYRDNKL
IWSSTPNLRSLSSSFDSNGYADITKDGLQWRTFQLSLPQTEHENEYVVVAEKQKIRKEII
HEIALSTSIEQLLLLPTLLLLLFWLIDRYFRPINDLRTAITQRNVHRLDRIHVTDNTTEL
APLVEALNSLLSELEQAWQREKRFTRAAAHELKTPLTILRLNVENALESNDPEQLRGDLH
NILQGIERTDRLIHQLLTLAKVDSLSERVFDNVELTPLLQTVVADLAPLALRQDQDISLS
PAEVALSGDKMLLEVLFRNLVDNAIRYSGAHSEIQVSVQENRNAIKILISDTGPEIPQET
RERIFEQFYRGHSEKGDGAGLGMSICKDIATLHSATIELIPRENGKNTFVVAFPKY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtggggtacattcttgaaaaataaaaaaccttactccattaaacgccaactgacg
ctctcggttggcttgttagtcagcgcgcttttgcttatttctttgtacttcagctttcag
tcagccaaacacgaagtcgaagaagtttatgacgctaggcttgggcaatccgctaagctg
atgctgctgacgctgtccatttcaaccgaaacggacacgctcgccaaccacagagagcta
ttcgaccagtggatgaagaacattgattctttggcaaagagcgacgaagacaaagccacc
aagtttggtcacccctacgagcagaatctcgtttttcaattctaccgtgacaacaagttg
atctggagttccactccgaatctgcgctctctttcttcttcttttgatagcaacggctac
gccgacattaccaaagacggcttgcagtggcgcactttccaactctcattaccacagact
gagcatgagaacgaatacgtggtcgttgctgaaaagcaaaagatacggaaagagatcatc
catgaaatcgctctgtcgacgtccatcgaacagttactactattgccgactttgctgctg
ttgctgttctggctgatagacaggtatttcagaccgattaacgatctacgcacggcaatc
acgcaacgaaacgtgcaccgcttagaccgcattcatgttaccgacaacacaaccgagctt
gctccgttggtggaagcactcaattcattgctttctgaacttgaacaagcgtggcagaga
gagaagcgctttacgcgagccgccgcacacgagctcaaaacgccgctgacaatcctgcgc
ctaaacgtagaaaacgctcttgaaagtaatgatccagagcagttacgcggagacttacac
aacatccttcaaggcattgaaagaaccgaccgtctcatccaccaactgcttacacttgct
aaagtagacagtttatctgaacgcgtctttgacaacgtcgaactaacgccattgctgcaa
accgtcgtcgccgatttagcgccacttgctttaagacaagatcaagacatcagcctttca
ccagcggaagtcgcgctttctggcgacaaaatgttgttagaagtgttgttccgtaacctt
gtagacaatgccattcgctattcaggcgcacacagcgaaatccaagttagtgtgcaagaa
aatagaaatgcgatcaaaatcttgatttccgacactggcccggagattccacaagaaacg
cgagaaaggatctttgaacaattctaccgaggtcactcagaaaaaggcgatggtgcaggg
ttgggcatgtctatttgcaaagacatcgccacgctacacagcgcaacaatagagctgatt
ccgagagaaaatggcaagaacacgtttgtcgtcgcattcccaaagtactag

DBGET integrated database retrieval system