KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_14760
Entry
M636_14760        CDS       T02760                                 

Definition
(GenBank) hypothetical protein
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
SSDB
Other DBs
NCBI-ProteinID: AGR00148
Position
I:complement(1378180..1378773)
AA seq 197 aa
MISDINEEYYVLMCGSGKVPSPYVSCSKSHYLIFQEPMSLKMPIRIESAAEAQEKVPLIE
AMAAPSDPVLSGRITQVLNYFDLYKVQLLPAIYTHNDDSEHSYSVLVVDNDIDAYDFDNG
LYIERLDDGEVGNPRNCRLDPEKLSKIPLEKRYIFKIRGMMDYLVHKTIAESLVALNASG
LHLVPVLEWDIGFGMKI
NT seq 594 nt   +upstreamnt  +downstreamnt
atgatttcagatattaatgaagagtattatgtacttatgtgtgggtctggtaaagtacct
tctccttatgtttcttgtagtaaaagccactatttgattttccaagaacctatgtcactt
aaaatgccaatccggatagagtcagcagctgaagcccaagagaaagttccattaatcgaa
gctatggctgccccgagtgatcctgtactttcaggtagaataacacaagtcctcaactac
tttgatctttataaagttcaattgctcccagctatatatacccataatgatgatagcgag
cactcttattcagtcttagttgttgataacgatattgatgcttacgattttgataacggc
ctatatattgagcgtttggatgatggtgaggttggaaacccaagaaactgtcgacttgac
cccgaaaaactttcaaaaatcccgttagaaaaacgttatatttttaaaatacggggcatg
atggattatttagtccacaaaacaattgccgaatctctagtcgcattgaatgcaagtgga
cttcacttagttccagtattggaatgggacattggttttggaatgaaaatttaa

DBGET integrated database retrieval system