KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_14770
Entry
M636_14770        CDS       T02760                                 

Definition
(GenBank) type VI secretion protein
  KO
K11892  type VI secretion system protein ImpK
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    M636_14770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpk02044]
    M636_14770
Secretion system [BR:vpk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M636_14770
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AGQ98460
Position
I:complement(1381079..1381885)
AA seq 268 aa
MGSSSMSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLNIENMGINPLVDQFSWL
IASLSCMSSIPWLDDPMPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVC
RQEWGANSHWSQNSLLSEFHNETSGGDKFFVILERLKADPRKYRHVIEFLYLLLQLGFQG
KYGREERGNEKLAEIGNTIYRLVRDERLAEQEKVSLVNLKAKYLKKPLKRVISPKLILGI
SAITFAIMYAATYIVIDLKFQQLLEVYR
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggcagttcgtctatgagttacgcagaaactgacgttactgtagtcttattccaacca
gagccaggcaaaccgatggaggtgatgccagcgcctgacttgtctcgtaatatcgcggta
caagacctaaacatcgaaaacatgggcatcaacccgttggtcgaccagttctcatggttg
atcgccagtttgtcttgtatgtcttcgattccttggcttgatgacccaatgccgtttcgt
gaacaagtggctcgtgagataagaaaaggcgagcgtaagctcaatgaaatggaactggat
cgcgcatccattttggtcatccgctactgtttgtgtgctgcgattgatgagtcggtctgc
cgacaagagtggggcgctaacagccattggagccagaacagtttgctgtcagagttccac
aatgaaacatctggcggtgataagttcttcgttattctcgagcgattaaaagcagacccg
cgcaaataccgtcacgttatcgagtttctgtatttgttgcttcaacttggctttcagggc
aaatacggccgtgaagagcgcggtaacgaaaagctagcagaaatcggcaatacaatttat
cgcttagtacgtgatgaacgcttagcagagcaagagaaagtctctctcgttaaccttaag
gccaaataccttaagaagccgttaaaaagggtgatttcacccaaactgattttaggcatc
agtgcgattaccttcgcaatcatgtatgccgcgacttacatcgtcatagatttaaagttt
cagcaattacttgaagtgtatcgataa

DBGET integrated database retrieval system