KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_14785
Entry
M636_14785        CDS       T02760                                 

Definition
(GenBank) signal peptide protein
  KO
K11894  type VI secretion system protein ImpI
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpk02044]
    M636_14785
Secretion system [BR:vpk02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   M636_14785
SSDB
Motif
Pfam: FHA Yop-YscD_cpl DUF4020
Other DBs
NCBI-ProteinID: AGQ98463
Position
I:complement(1383697..1385205)
AA seq 502 aa
MQTHQLVLFISKCPEEYTGAKHIEMPEGGGSVGRAPSCTLSLTDHNRFISGTHCLISVYG
DTFYISDVSTNGTMVNGNKILKNQPISIVDGDVVSLGQYEIGVALEHISAVQDIAADIAP
ERVSNDPLVNLGEAVVEEEEKVGSLEDLFMETKQDGVNTDDPIAHLKFSMQREDDYLIRD
VEKPEPAKTIENTRQVVDDSFSIHSEFDIPNLIPEDWLGGVATSKESVEPATEQAKQAAF
IPEDFAHTKPVSPQASVVQPDVNQPQQPQYEAPLNHATSNVTQRAEPVSQKWEEVTQAFV
PSAQPTQPETKAKEAQQGFVSNESLAIESAAHSSDIGKAFYEGLGISNPDLISNEALLFK
QMGACLRLCIDNLQKDLHEVESLKGEQGLSEADSNLAELMLTLNSQNLLSPNELVEQMLD
ELNDHQIIFNKALNELLIEQSETNDPVTFANDVASKSMFTTKSKLWGEYLEFYANNRRQM
NETSLKGLIKKNYTKAIKGSHA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcaaacacatcagctagtcctatttatttctaaatgcccagaggaatatacgggcgca
aagcatattgaaatgccagaaggtggtggctcagttggacgagcgcctagctgcactctg
tctttaacggaccataaccgttttatctctggtacacactgtttgataagtgtatacggt
gacactttctacattagcgatgtgtcgacaaatggcactatggttaatggtaataagatt
ctaaagaatcaaccgatatctattgttgacggtgacgttgtttcattagggcagtacgag
attggcgttgcattagagcatatatccgctgttcaagatattgccgccgatattgcccca
gaaagagtatcgaatgatccactcgtcaatctcggtgaggcggttgtagaagaggaagaa
aaagtcggttcattagaagacttattcatggagaccaagcaagacggtgttaatactgac
gatcctattgcgcatctaaagttttcgatgcagcgtgaagacgactatcttatccgcgat
gttgaaaagcctgagccggctaagacaatcgaaaatacgcgacaagtcgttgatgacagt
ttcagtatccattccgaattcgatattccaaatttaatccctgaagattggctgggaggc
gttgccacgagtaaagaatctgttgaaccagcgacagagcaagctaagcaagccgcgttc
attccagaagattttgcgcacacgaagcccgtttcgcctcaggctagtgtggttcaacca
gacgttaaccaacctcaacagcctcaatatgaagcgccacttaatcatgcgacgtcaaat
gttactcaaagagcagagcctgttagccagaaatgggaagaggtaacacaagcctttgtt
ccatcagcacaacctactcagccagaaacgaaagcgaaagaggcccaacaaggttttgta
agcaacgagtctctagcgattgagagtgcggctcattcttcagatatcggtaaagcattt
tatgaaggcttgggtattagtaaccctgatctgatcagtaacgaagctctgctgtttaaa
caaatgggggcatgtcttcgtttgtgtatagataacttgcaaaaagacttgcatgaagtt
gagtcacttaaaggtgaacagggtttaagcgaagcggattcaaacttagcggaactgatg
ttaacgctaaatagtcagaacttgctgtctccgaatgaattggtggagcaaatgttggat
gagctcaacgatcatcaaattatttttaacaaggcactcaatgagttgctaattgaacaa
tcagagacgaatgaccctgtcacgtttgcaaacgacgttgcaagtaaatccatgttcacc
accaaatcaaagttatggggtgagtatcttgagttctacgccaataaccgtcgtcaaatg
aatgagacgtcattgaaaggtttgatcaagaaaaactacaccaaagcgattaagggaagc
catgcgtag

DBGET integrated database retrieval system