KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_14795
Entry
M636_14795        CDS       T02760                                 

Definition
(GenBank) type VI secretion protein
  KO
K11911  type VI secretion system protein VasL
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpk02044]
    M636_14795
Secretion system [BR:vpk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M636_14795
SSDB
Motif
Pfam: ImpA_N Poty_PP
Other DBs
NCBI-ProteinID: AGQ98465
Position
I:1386319..1387644
AA seq 441 aa
MELNIMFFSDFTRRPIDESNPSGTNPNGLDDFDEIKRQINGLNKVTGRVSWKTVQTLSKE
ILRTKGKDFRCSCYFTVAAINNDGLKGLVEGLNSVLDLCVVYWFSAYPEYTKANARISAI
EWMVEYTEKRMKKHRVLPEELPLIEAAHQLCLRIEEELRLHYGIKAPSFGRIRRPLNQWI
EEIKEEKTRQEKTSQTKPAATKPAANPPSAGIRVEIAPPNRPVQKKVEQPKVEEEAKSSR
FIIYTMIGLLIIAFTSHFIYKQHQYTILKERIGSASLTELVTIVNSLSVENKNYQDDLRS
VTVERLHTLMSGWTLDPVKVSQVNTIEQLTNDLTKLYPDSSSAQQLRDNFLGQRSYFEDE
FEAIYKRFAYARTVFANIAKQSADKDAKKAYEYSNSLFPLLGRIEYAEKNSQRKEIERSL
LLLNAYLYKINQLQAAEKDNK
NT seq 1326 nt   +upstreamnt  +downstreamnt
ttggaacttaacattatgtttttcagcgactttacaagaagaccgatcgatgaaagtaat
ccaagcggtaccaatccaaatggcttagacgactttgatgaaataaaacgtcaaataaat
ggcttgaacaaagtaacaggccgtgtgtcatggaagacagttcagacactatcaaaagaa
atccttagaacgaaaggcaaagactttcgctgtagctgttactttactgtggcagccatt
aataatgacggactaaaaggcctagttgagggcttaaattctgtgctcgacttgtgtgtt
gtttattggttctccgcctatcctgagtacacaaaagctaatgcccgtattagtgcgatt
gaatggatggttgagtacactgaaaaacgaatgaagaaacaccgagtcctgccggaagaa
ctccccctaattgaagcggctcatcagctttgtctacgtatcgaagaggaacttcgcctt
cactatggtattaaggcaccttcttttggacgtattcgtcgtcccctaaatcagtggatt
gaagagattaaagaagaaaagacgagacaagagaaaacctcacaaacaaaacctgcggca
acaaaacctgcggcaaatcctccttcagcaggcatccgagtcgaaatagcaccgcccaat
agacctgttcaaaagaaagtagagcagcctaaagtggaagaagaggccaaatcaagccga
ttcattatctatacaatgatcggattgctgatcatagcttttacgtctcacttcatatac
aaacagcatcaatacacaatactcaaggaaagaattgggtcagcatcacttactgaatta
gtgacgattgttaactcgctcagtgtcgaaaacaaaaattaccaagatgacttgcgctct
gtcacggttgagcgtcttcatactttgatgtcaggttggacattagatccagtcaaagtg
agccaggtcaataccattgaacagttaacgaatgacctgaccaagctctatccagactca
tcctctgcacaacaacttcgcgataattttttaggccagcgttcttattttgaagatgaa
tttgaggctatatacaaacgttttgcatatgctagaacggtctttgccaacattgcaaaa
caaagtgcagacaaggacgctaagaaagcatatgagtacagcaattcgctatttcccctt
cttgggcgaattgaatatgcagaaaagaactctcagcgaaaggaaattgaacgatcactt
cttttgctgaacgcttacctatataaaatcaaccagctacaagctgcagaaaaagacaat
aaataa

DBGET integrated database retrieval system