KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_14835
Entry
M636_14835        CDS       T02760                                 

Definition
(GenBank) type VI secretion protein
  KO
K11910  type VI secretion system protein VasJ
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vpk02044]
    M636_14835
Secretion system [BR:vpk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M636_14835
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N DUF4864 TraS HsbA
Other DBs
NCBI-ProteinID: AGQ98473
Position
I:complement(1396847..1398421)
AA seq 524 aa
MSVIEIERLLAPISDVNPVGEDARYEFCYEMMESEVKKFGSLFGETVDWSVVKTHAIEVL
EHHSKDLKAICYLVRALTEEFGLQGFEQGLKLLSEALNRFGVELYPSRKRGRDGAVEWLN
HQFKLVSSRFAESAQSWDLVSGCISIIEEVQRQYDDIYQDSEADFFEIRSQLNVLSQQAT
VDDQSDGAMATIEQTAPLTASQPVAVETPAQSEVQTVVEKALPSAPKPAPVKKTVTKEVD
VDTDFSSPTASKRTLKKVAEVMIHANPSEPLAYRIYRHLTWDDIDGLPDHQSNETPLSLA
VSSDQQAEYRDKASQESDIDTVKRLERTLTDAPFWLTGHYFVYSMLNNLGFNDAALAVKQ
EVKRFVDSLEGIELLTFKNSIPFADEATLSWLSTQAATSSSAQSVVQTIVITDEDSLPME
DITLANLGEYAAELAHKLELDFSGRGQFMLHLQLIAAYQSVGLYPLCLPYLEKAWEVQQA
FNLASWEPHLSSQLEDLIRKTLHQLFRNKDLLPEKYEKWKAIYD
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgtgatcgaaattgaacgtttacttgcgcctatctctgacgtaaatcctgtcggt
gaagatgctcgttacgaattttgttatgaaatgatggaatccgaagtgaagaagttcgga
tccttgtttggcgaaacggtagattggagtgtcgtaaaaacgcacgccattgaagttctt
gaacaccacagcaaagatttaaaagcaatttgttaccttgttcgcgcgcttacagaagaa
tttggtctgcaaggtttcgagcaaggtctaaagctgcttagtgaagcgttaaatcgtttt
ggcgttgagctgtacccgtcgcgaaaacggggtagagatggtgcggtagagtggttgaac
catcagtttaaattggtgagcagcaggtttgcagaaagcgcccaatcatgggatttggtt
tcaggttgtatttcgattatcgaagaagtccaacgtcagtacgacgatatttaccaagac
tccgaagcggacttctttgaaattcgtagtcaactcaatgtgctatctcaacaagcgact
gtcgatgaccaaagcgatggtgcaatggctaccatcgaacaaacagctccgctaacggct
tcacagcctgtagcagtagaaactccggcacaaagtgaagttcaaaccgttgtagaaaaa
gcgcttccgtcggctcctaaacctgcaccagttaagaaaacagtaacaaaagaagtcgat
gtcgatacggatttttcatcgccgaccgcttctaaacgtacacttaagaaagttgcggaa
gttatgattcatgcgaatccaagtgagccgctagcttaccgaatttatcgtcacctaact
tgggatgatattgatggtcttcctgatcatcaaagcaatgaaacgccattgagtttggct
gtgtcgtctgatcagcaggctgagtaccgcgataaagcctctcaagaaagcgacattgat
acagttaagcgtttggagcgcacgttaaccgatgctccgttttggctgacgggtcactac
tttgtttattcgatgttaaacaacctaggctttaatgacgcagcgctcgctgtgaagcaa
gaagtgaagcgttttgttgattcattagagggcattgaactcctcacatttaagaattct
ataccatttgcagatgaagcaacgttgagctggttatcgactcaagctgcaacttcttca
agtgctcaatctgtcgttcaaacgattgtcatcacagatgaagactcactgccaatggaa
gatatcaccctagccaacttaggggagtatgccgcagaactcgcacacaaactcgaactg
gatttctcgggacgtgggcagtttatgctgcatttacaattgatagcagcttaccagtct
gttggattatacccgttgtgtttgccttaccttgaaaaagcttgggaagtgcaacaagcg
tttaatctcgcgagctgggaaccccacttatcgtcacagctagaagacctgattcgaaaa
acactgcatcagttattcagaaacaaggatcttttgcctgagaagtacgaaaagtggaaa
gcaatttatgactaa

DBGET integrated database retrieval system