KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_15270Help
Entry
M636_15270        CDS       T02760                                 

Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk00860  Porphyrin and chlorophyll metabolism
vpk01100  Metabolic pathways
Module
vpk_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M636_15270
Enzymes [BR:vpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     M636_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF5609
Motif
Other DBs
NCBI-ProteinID: AGQ98543
Structure
PDB: 

Position
I:complement(1509082..1509696)
Genome map
AA seq 204 aa AA seqDB search
MKTLNIYLMRHGKVDAAPGLHGQTDLKVKEAEQQRIAMAWKTKGYDVAGIISSPLSRCHD
LAQILAEQQLLPMTAEDDLQEMDFGDFDGMPFDLLTEHWKKLDVFWQSPAHHPLPNAESL
STFSQRVSRAWSQIINDINDNLLIVTHGGVIRIILAHVLGVDWRNPQWYSTLAIGNASVT
HITITIDDQIYASVRSIGVPLVED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctcaatatctatcttatgcgtcatggaaaagtagacgccgcgcctggctta
catggtcagactgatctcaaagtgaaagaggccgagcagcagcgaatcgccatggcttgg
aaaaccaaaggatacgacgtagcggggataatatcgtcgccgctttctcgttgtcacgat
ttggcgcaaatattagctgagcaacaattgttgccaatgaccgccgaagacgatctgcaa
gaaatggactttggtgacttcgacggcatgccatttgatttgcttactgaacattggaaa
aaactcgatgtcttttggcaatcacccgctcaccatccgttgcctaatgccgagagctta
agcacattttctcagcgcgttagtcgcgcttggtctcaaatcattaacgatatcaatgac
aacttgttaattgtcacgcatggtggcgtaattcgaataattctcgctcatgttttgggc
gtggattggcgcaatcctcaatggtattcgacattggcgataggaaatgcctcagtcact
catataacaattactattgatgaccaaatttacgcctcagttcgttcaataggcgtgcct
cttgtagaagattaa

DBGET integrated database retrieval system