KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_20555Help
Entry
M636_20555        CDS       T02760                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk00010  Glycolysis / Gluconeogenesis
vpk00030  Pentose phosphate pathway
vpk00051  Fructose and mannose metabolism
vpk00680  Methane metabolism
vpk01100  Metabolic pathways
vpk01110  Biosynthesis of secondary metabolites
vpk01120  Microbial metabolism in diverse environments
vpk01130  Biosynthesis of antibiotics
vpk01200  Carbon metabolism
Module
vpk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M636_20555
   00030 Pentose phosphate pathway
    M636_20555
   00051 Fructose and mannose metabolism
    M636_20555
  09102 Energy metabolism
   00680 Methane metabolism
    M636_20555
Enzymes [BR:vpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     M636_20555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AGQ99393
Position
I:2652480..2653487
Genome map
AA seq 335 aa AA seqDB search
MKRDLAMAFSRVTEGAALAGYKWLGRGDKNAADGAAVEVMRTLLNKTDISGEIVIGEGEI
DDAPMLYIGEKVGLGGDEVDIAVDPIEGTRMTAMGQSNALAVLAAGEKGSFLKAPDMYME
KLVVGPGAKGVIDLEKPLKENLENVAGALNKTLDTLVVITLAKPRHDDVIAEMQSMGVRV
FAVPDGDVAASILTCMPDSEVDLMYCIGGAPEGVVSAAVIRALDGDMHGRLLPRHEVKGD
TEENRIYGAAELQRCEEMGVKANVVLKMEDMARSDNVVFSATGITKGDLLEGISRQGNIA
TTETLLVRGRCRTIRRIKSTHYLERKDPEVRDIIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgatttagcaatggcattttctcgtgtaactgaaggtgctgcactcgctggt
tacaaatggcttggccgtggtgacaaaaacgcagccgatggcgctgctgttgaagttatg
cgcactctactgaacaaaacagacatcagtggtgaaattgtcattggtgaaggtgaaatc
gatgatgcaccaatgctatacatcggtgagaaagttggtctaggtggcgatgaagtggat
atcgctgttgaccctattgaaggcacacgcatgactgcaatgggtcaatcaaacgcattg
gcagtgcttgccgcgggtgaaaaaggcagctttttaaaagcacctgacatgtacatggaa
aaattggttgttggcccaggtgcgaaaggcgtgatcgatctagaaaagccgttgaaagaa
aacctagaaaacgttgctggtgcgctaaataaaacgctggacactctggttgtcatcact
ctagcaaaacctcgccacgatgatgtgatagcagaaatgcaatcgatgggtgtgcgtgtc
ttcgcggtgccagatggcgacgttgcagcttccatcctaacgtgtatgccagatagtgaa
gtggacctcatgtactgcattggcggtgcaccagagggggtggtatccgcagcggtgatt
cgcgcacttgatggtgacatgcatggccgtcttctacctcgccacgaagtgaaaggcgac
acagaagaaaaccgtatttacggtgcggctgaactacaacgttgtgaagaaatgggcgta
aaagccaacgtcgtcctaaaaatggaagacatggcgcgcagcgacaacgtcgtcttctca
gcaacaggcattacaaaaggtgacttgctagagggaatttctcgccaaggcaatattgcg
acaacagaaacgctactcgtgcgaggccgttgccgtaccattcgccgtatcaagtcgacc
cattacttagagcgcaaagatccagaagttcgcgatatcattctgtaa

DBGET integrated database retrieval system