KEGG   Vibrio parahaemolyticus O1 K33 CDC_K4557: M636_21150Help
Entry
M636_21150        CDS       T02760                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
vpk  Vibrio parahaemolyticus O1:K33 CDC_K4557
Pathway
vpk00010  Glycolysis / Gluconeogenesis
vpk00020  Citrate cycle (TCA cycle)
vpk00620  Pyruvate metabolism
vpk01100  Metabolic pathways
vpk01110  Biosynthesis of secondary metabolites
vpk01120  Microbial metabolism in diverse environments
vpk01130  Biosynthesis of antibiotics
vpk01200  Carbon metabolism
Module
vpk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M636_21150
   00020 Citrate cycle (TCA cycle)
    M636_21150
   00620 Pyruvate metabolism
    M636_21150
Enzymes [BR:vpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     M636_21150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AGQ99476
Position
I:2774144..2775772
Genome map
AA seq 542 aa AA seqDB search
MTVMEHTKAATLDLTKHGLHNVKEVVRNPSYELLFEEETRADLTGYERGVVTELGAVAVD
TGIFTGRSPKDKYIVKDATTEEHMWWTSDTVKNDNKPITQEVWNDLKELVTNQLSGKRLF
VVDGYCGANPDTRLSIRVITEVAWQAHFVKNMFIRPTEEELATFEPDFVVMNGAKCTNPK
WEEQGLNSENFTVFNLTERTQLIGGTWYGGEMKKGMFAMMNYFLPLKDIASMHCSANMGK
DGDVAVFFGLSGTGKTTLSTDPKRALIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPD
IYNAIRRDALLENVTVRSDGSIDFDDGSKTENTRVSYPIYHIENIVKPVSKGGHANKVIF
LSADAFGVLPPVSKLTPEQTKYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPT
KYAEVLVKRMEAAGAEAYLVNTGWNGTGKRISIQDTRGIIDAILDGSIEDAPTKHIPIFN
LEVPTSLPGVDPSILDPRDTYVDPLQWESKAKDLAERFINNFDKYTDNAEGKALVAAGPQ
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttatggaacatacaaaggctgcaacacttgatctaaccaaacacggactgcat
aacgttaaagaggttgttcgcaacccaagctacgaattgctgtttgaggaagaaacgcgc
gctgacctaactggttacgaacgcggtgtggttactgaattaggtgcggttgctgttgat
acaggcatctttactggtcgctcaccaaaagataaatacatcgttaaagatgcgacgaca
gaagaacacatgtggtggacttctgacaccgtaaaaaatgacaacaaaccaatcactcag
gaagtgtggaacgacctaaaagagttggtgactaaccagttgtctggcaaacgcctattt
gtcgttgacggttactgtggtgctaacccagatactcgcttgagcattcgtgtaatcacg
gaagtagcatggcaagcacacttcgtaaaaaacatgttcattcgtcctaccgaagaagaa
cttgcaacgtttgaacctgacttcgtagtaatgaacggcgcgaaatgcaccaacccgaaa
tgggaagagcaaggtctgaactctgaaaacttcacggtcttcaaccttactgagcgtaca
caactgatcggtggtacgtggtacggcggcgagatgaagaaaggtatgttcgcgatgatg
aactacttccttcctctgaaagacatcgcatcgatgcactgtagtgccaacatgggcaaa
gacggcgacgtagcagtattcttcggcctatctggtacaggtaaaacaacactctctacc
gaccctaaacgcgctctaattggtgatgatgagcacggctgggatgacgatggtgtcttc
aacttcgaaggcggttgttacgcgaaaaccatcaagctatcgaaagaagcggagccagac
atctacaacgcgatccgccgcgatgcgctgctagaaaacgtaacggttcgtagcgacggc
tctatcgattttgatgacggctctaagacagaaaacacacgtgtttcttaccctatctac
cacatcgaaaacatcgttaagccagtatcaaaaggcggtcacgcaaacaaagtgatcttc
ctatcggcagacgcatttggcgtgctaccgccagtgtctaagttgactccagagcaaacc
aaataccacttcctatctggctttactgcaaaactggctggcacagagcgaggcattact
gagccaacaccaacattctctgcatgttttggcgcagcgttcctaacgcttcacccaact
aaatacgcagaagtactggtaaaacgtatggaagccgcaggtgcagaagcatacctagtg
aacaccggctggaacggcacaggtaaacgtatctctatccaagatacacgcggcatcatt
gatgcgatcctagatggctcgattgaagatgcgccaactaagcacattccaatcttcaac
cttgaagtaccgacttcactaccaggtgtggatccaagcatccttgaccctcgtgacacg
tacgttgacccactacaatgggaaagcaaagcgaaagacttggctgagcgctttatcaat
aactttgataagtacactgacaacgcggaaggtaaagcactggttgcggctggtcctcaa
ctggactaa

DBGET integrated database retrieval system