KEGG   Virgibacillus dokdonensis: A21D_00905Help
Entry
A21D_00905        CDS       T05261                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00030  Pentose phosphate pathway
vpn00480  Glutathione metabolism
vpn01100  Metabolic pathways
vpn01110  Biosynthesis of secondary metabolites
vpn01120  Microbial metabolism in diverse environments
vpn01130  Biosynthesis of antibiotics
vpn01200  Carbon metabolism
Module
vpn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vpn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A21D_00905 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A21D_00905 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vpn04147]
    A21D_00905 (zwf)
Enzymes [BR:vpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A21D_00905 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A21D_00905 (zwf)
Exosome [BR:vpn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A21D_00905 (zwf)
  Exosomal proteins of colorectal cancer cells
   A21D_00905 (zwf)
  Exosomal proteins of bladder cancer cells
   A21D_00905 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AUJ24017
UniProt: A0A2K9IWB3
Position
981828..983300
Genome map
AA seq 490 aa AA seqDB search
MKTVDKPNVVIVIFGATGDLSKRKLFPSIYRLYQNGKIGEDFAVVGLARRPWTNDIFREK
VCESINESESNNQIDLEAFASHFYYQSFDVTDSSSYTHLDGLLNHLEGQYQTDGNRIFYL
AMAPEYFGTIANQIEQNGLKESVGWTRLVIEKPFGHDHTSAKALNNQIRLAFNEDQIYRI
DHYLGKEMVQNIEVIRFANGIFEHLWNNRFISNIQVTSSEKLGVEERARYYDRSGATRDM
VQNHMLQMVALLAMEPPIKLTPEEIRSEKVKVLRALRLVEPTEVENYFVRGQYGPGPLGK
GYREEAPELKNSITETYVAGKVMIDNYRWAGVPFYIRTGKKMKEKSIKIVVEFKDIPMNL
YYKDEAKRHPNLLVINIQPDEGITLHLNAKKAGIGSIAQPIELSYTNNGVDGINTPEAYE
KLIYDCIIGDTTNFTHWDEVAYSWKYVDAVLDAWSKTEPLFPNYAAGSMGPEAADRLLEK
DGFHWWPITD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacggtggataaaccaaacgtcgtgattgtcatctttggagcaacaggggattta
tcaaaaagaaagttattcccttccatttatcgtctttatcaaaacggaaaaattggtgag
gattttgcagttgttggtcttgctcgccgtccgtggacgaatgatatctttcgcgaaaaa
gtatgtgaatcaataaacgaatcagaatcaaacaatcaaatagacctagaagcatttgct
tctcatttttattatcagtcttttgatgttacagatagttcatcttatacccatttagat
ggattgttaaaccatctagaaggtcaataccaaacagatgggaatcgaattttttactta
gctatggctccggaatactttggaacgattgctaatcaaattgaacaaaacggtttaaaa
gaaagtgtaggctggacaaggttggtcattgaaaagccattcgggcacgatcatacctcg
gcaaaagcgttgaacaatcaaatccgattagcatttaatgaagatcaaatatatcgtatt
gaccattatttaggaaaagaaatggtgcaaaatattgaagttattcgctttgcaaacggg
atatttgaacatttatggaacaaccgatttatttccaatatccaagttacgtccagtgaa
aaactcggtgtcgaagaacgcgcgcgatattatgatcgctcaggagcaacaagagatatg
gtgcaaaaccatatgcttcaaatggtcgccttactagcaatggagccgcccattaagcta
actcccgaagaaatacgttcagaaaaagtgaaagtattacgagctctgcggcttgttgaa
ccaacagaggttgaaaattatttcgtccgtggccaatacggtccaggccctctaggaaaa
ggatatcgcgaagaagcgccagaattgaaaaactcgatcacagaaacgtacgttgctggg
aaggtaatgattgataactatcgttgggcaggcgtccctttctatattcgaacaggtaag
aaaatgaaagaaaaatcaattaagatcgttgttgaatttaaagatattccaatgaatcta
tattataaggatgaagcaaagagacatcctaatctgctcgtcatcaacattcaaccagac
gaaggcattacacttcatttaaatgcaaaaaaagctggtataggttccattgcccaacca
attgaattatcttatacaaacaatggtgtcgatggaataaacacaccagaagcttatgaa
aaattaatttacgattgtattatcggtgatacgactaactttacccattgggatgaagta
gcctattcatggaaatatgtagatgctgttttagacgcatggtcaaaaacagagcctctg
tttccaaattacgctgccggatcaatgggaccagaagcggcagaccgcctacttgaaaaa
gacgggttccattggtggccaataaccgattaa

DBGET integrated database retrieval system