KEGG   Virgibacillus dokdonensis: A21D_00972Help
Entry
A21D_00972        CDS       T05261                                 

Gene name
argS_2
Definition
(GenBank) Arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A21D_00972 (argS_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vpn01007]
    A21D_00972 (argS_2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vpn03016]
    A21D_00972 (argS_2)
   03029 Mitochondrial biogenesis [BR:vpn03029]
    A21D_00972 (argS_2)
Enzymes [BR:vpn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     A21D_00972 (argS_2)
Amino acid related enzymes [BR:vpn01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   A21D_00972 (argS_2)
Transfer RNA biogenesis [BR:vpn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A21D_00972 (argS_2)
 Prokaryotic type
   Other AARSs
    A21D_00972 (argS_2)
Mitochondrial biogenesis [BR:vpn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A21D_00972 (argS_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1 tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f NUDIX a_DG1_N2
Motif
Other DBs
NCBI-ProteinID: AUJ24084
UniProt: A0A2K9IXE7
Position
complement(1059609..1061273)
Genome map
AA seq 554 aa AA seqDB search
MNVLVQTEETLKQQIRDAVLRASLASEEEIPEILLEKPKDKRHGDFATNIAMQLARVAKK
APRQIAEELVNEFNRVKASVEKVEIAGPGFINFFMKEDFLGSIVPNILQEGEAYGRSRAG
NNERVQVEFVSVNPTGDLHLGHARGAAFGDVLCNVFDAAGYRVEREYYINDAGNQIDNLA
LSIEVRYLQALGQDVSMPEDGYYGEDITEIGKQLREEYGDQWVQKDREERLAFFKEYGLS
YELGKIKEDLQAFKVHFDSWFSERSLYKENKIGETLEKIATYTYEKDGATWFRSTEFGDD
KDRVLIKQDGTYTYLTPDIAYHKNKLDRGFDQIINVWGADHHGYIPRMRAAIQALGYPAE
KFSVKIVQMVNLFADGEKVRMSKRTGQAVALRELIEEVGVDAVRYYFVMRSNDSQLDFDM
DLARSESNDNPVFYVQYAHARICTMLKQAEAKGLSVDSDADVSLLTAEKETDLLKKLAAF
PQVIADAAQMQTPHKVTQYVFDLASLLHSFYNAEKVLDMDHLERTKARIAFMQAVKITLA
NGLRVLGVTAPEKM
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtattagtgcaaacagaagagacattgaaacaacaaattagggatgccgtcttg
cgagcgagtcttgcaagtgaagaagaaataccagaaattttgcttgaaaaaccaaaagat
aaaaggcatggggattttgcgacaaatattgctatgcaactagcacgtgttgcaaaaaaa
gcgccacgtcaaattgcggaagaattagtaaacgagtttaatagagtgaaggcatctgtt
gaaaaggtagaaattgcagggccaggctttattaacttttttatgaaagaggattttcta
ggctcgattgttccaaatattttacaagagggagaagcctatggaagatcacgagctggt
aataatgagcgtgtacaagtggagtttgtctctgtgaatccaacgggtgatttgcattta
ggtcatgcaagaggcgcggctttcggagatgtcttatgtaacgtattcgatgctgctggt
tatcgggttgaacgagaatactatattaatgatgctggaaatcaaatcgataatttagcc
ttgtctatagaagtacgctatttgcaggcattaggtcaagacgtatccatgcctgaagat
ggctattatggtgaagatattacggaaattggtaaacaattaagggaagaatatggagat
cagtgggtacaaaaagatagggaagaacgtttagctttctttaaagaatatgggttaagt
tatgaactgggtaaaattaaagaagatttacaagcattcaaagttcattttgactcgtgg
ttttctgagcgctccctttataaggaaaataaaattggagaaacactagaaaaaatagcc
acctatacatacgaaaaagatggtgctacatggttccgtagtacggaatttggcgatgat
aaggatcgcgttttaattaaacaagatggtacttatacttatttaaccccggatattgcg
tatcataagaacaaattggatcgtgggtttgatcaaattattaacgtttggggtgccgat
catcatggctatatcccgcggatgcgtgctgcgattcaagcgttaggctatcccgctgaa
aagttttccgtgaaaatcgtgcaaatggtaaatttatttgcggatggcgaaaaggtgcgg
atgagcaaacgtactggtcaagctgtagcattaagagaacttatagaagaagtcggggta
gacgctgttcgctattattttgtaatgcgttccaatgattcacagcttgattttgatatg
gatcttgctcgatctgaatcgaatgataaccctgttttttatgtgcaatatgcacatgca
agaatttgtacgatgttaaagcaagcagaagcgaaaggactttctgttgatagtgatgcc
gatgtttcgcttttaaccgctgaaaaagaaaccgatttgttaaaaaaattagctgccttt
ccgcaagttatcgctgatgcagctcaaatgcagacaccacataaagtaactcagtatgtg
tttgacttggcgtccttgctacacagtttttataatgcggaaaaagtattagatatggat
catctcgaaagaacgaaagcgcgtattgctttcatgcaagctgtcaaaattacattggcg
aatggtttacgcgtgttaggtgtaacggcgccagagaaaatgtag

DBGET integrated database retrieval system