KEGG   Virgibacillus dokdonensis: A21D_01091Help
Entry
A21D_01091        CDS       T05261                                 

Gene name
rocF
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00220  Arginine biosynthesis
vpn00330  Arginine and proline metabolism
vpn01100  Metabolic pathways
vpn01110  Biosynthesis of secondary metabolites
vpn01130  Biosynthesis of antibiotics
vpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A21D_01091 (rocF)
   00330 Arginine and proline metabolism
    A21D_01091 (rocF)
Enzymes [BR:vpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A21D_01091 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AUJ24203
UniProt: A0A2K9IZI4
Position
complement(1185295..1186197)
Genome map
AA seq 300 aa AA seqDB search
MKSTISIIGVPMDLGQSRRGVDMGPSAMRYAGAVERLEALGYTLHDYGDIGITRPDKQET
GRSYQLKNLPQVVEANEKLATMVDQTIKKGHFPLVFGGDHSIAIGSLAGIAKHYEQLGVI
WYDAHGDLNTKETSPSGNIHGMPLAVSLGFGHELLTSIAGYSPKVKPENIVIIGARSLDP
GERELIREKGIQVYTMHEVDRLGMSNVIEKAVAYLSPRTDGVHVSVDLDGLDPSEAPGVG
TPVIGGMTYRESHLAMEMLAEAGIITSAEFVEVNPILDEKNKTATLAVGLMGSLFGEKLK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacgatatcaattattggggttccgatggatttggggcagagtagacgtggg
gtagatatggggccgagtgcaatgcgttatgctggagcggtggaaaggttagaagcattg
gggtatacgttacatgattatggtgacattggtattactcgacctgacaaacaagaaacg
ggacgaagttaccaactaaagaatttacctcaagtagttgaagcaaatgaaaaattagca
acaatggttgatcaaacaataaaaaaaggccattttccgttagtttttggtggtgaccat
agcattgctatcggaagtttagcagggattgctaaacattatgaacagcttggagttatt
tggtatgatgcgcatggggatttgaatacgaaggagacttctccatctggtaacatccat
ggaatgccacttgctgtaagcttaggcttcggtcatgaactgttaacatcgattgcaggg
tactcacctaaggtaaagccagaaaacattgttattattggagctcgttccctcgatcct
ggagagagggagttaatacgtgagaagggaatacaagtttataccatgcatgaagtagat
cggttagggatgtcgaacgtcatcgagaaagcggttgcttatttaagtcctcgtactgat
ggagtgcatgtaagcgtagacttagatggtcttgatccgtctgaggcgccaggagtaggt
acaccagttattggtggaatgacttatcgtgaaagtcatttagctatggaaatgttagca
gaggcaggaatcattacgtccgccgaatttgtggaagtcaacccaattctagatgagaaa
aataaaacggcaacgcttgctgtcggtttaatgggctcattatttggcgaaaaattaaag
tga

DBGET integrated database retrieval system