KEGG   Virgibacillus dokdonensis: A21D_01389Help
Entry
A21D_01389        CDS       T05261                                 

Gene name
metG_4
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00450  Selenocompound metabolism
vpn00970  Aminoacyl-tRNA biosynthesis
vpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A21D_01389 (metG_4)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A21D_01389 (metG_4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vpn01007]
    A21D_01389 (metG_4)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vpn03016]
    A21D_01389 (metG_4)
Enzymes [BR:vpn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A21D_01389 (metG_4)
Amino acid related enzymes [BR:vpn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A21D_01389 (metG_4)
Transfer RNA biogenesis [BR:vpn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A21D_01389 (metG_4)
 Prokaryotic type
   Other AARSs
    A21D_01389 (metG_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Zn-ribbon_8 tRNA-synt_1c ARL2_Bind_BART HTH_Tnp_1 tRNA-synt_1d DUF1272 DNA_ligase_ZBD zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: AUJ24472
UniProt: A0A2K9IXJ0
Position
complement(1468405..1470360)
Genome map
AA seq 651 aa AA seqDB search
MSNNENTFYITTPIYYPSGNLHIGHAYSTVAGDAMARYKRLRGFDVMYLTGTDEHGQKIQ
KKATENGVSPQEYVDHIVDGIQKLWKKLKISNDDFIRTTEERHKKIVAQIFDQLVKQGDI
YLDEYEGWYCTSCESFFTERQLDDSRCPDCGGPVEKVKEESYFFKMSKYVDRLVQFYEDN
PTFIQPESRKNEMLNNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALTNYITAL
GYGTEDDTKYQKYWPADVHLMSKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWILMKDGK
MSKSKGNVIDPVQLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERTNYDLANDLGNLL
NRTVAMINKYFAGKMPAYRASETEFDSALEAFGKQTIEKVEAAMEEMQFSVALGAIWQLI
SRTNKYIDETEPWMLAKDDANKERLGNVMAHLAEYLRKAAVMLQPFLTEAPAEIFRQLGI
TEDKLKEWNSLYEEGHITAERMVVSKGKPIFPRLDAKDEIQAIKAMMNPPKTKEEKVEDK
AEKEQIVFDDFMKIDMRVAEILQAEPVKKADKLLKLQLDLGTEKRQVISGIAEHYKSEEL
VGKKVICVTNLKPVTLRGEKSEGMILSGEDATGKLSLASVENSLPNGSVVK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataatgaaaacacattttatataactacaccaatttattaccctagtggtaat
ttgcatattgggcatgcatattcaacagttgccggagatgcaatggctcgatataaacgg
ttacgtggttttgatgtgatgtatttaacaggaacagatgagcacggacaaaaaatacag
aagaaagctactgaaaatggcgtctcaccacaggaatatgtcgatcacattgtggatgga
attcaaaagctatggaaaaaactaaaaatatctaatgatgattttatccgtacgacagaa
gagcgtcataaaaaaattgtcgctcaaatctttgatcaacttgttaaacaaggtgacatt
tatttagatgaatatgaaggctggtactgtacgtcttgtgaatccttttttacggaacgt
caactagatgatagtcgttgcccagattgcggtggtccagttgagaaagtgaaggaagaa
tcctacttctttaaaatgagcaagtatgtcgaccgtcttgttcagttttatgaggacaat
ccaacttttattcaacctgaaagtcgtaaaaatgaaatgctaaataatttcattaaacca
ggactagaggatttagctgtttctcggacgacctttgattgggggattaaagttcctggt
gatccaaaacatgttatttatgtatggattgatgccttaacgaactacataacggcatta
ggatatggaacagaggatgacacaaaatatcaaaaatattggccggcagatgtgcattta
atgagtaaagaaattgtacgtttccatactatttattggccaattatgttaatggcgcta
gatcttccgttaccgaaaaaggtgtttgcacatggttggattttaatgaaggatggaaaa
atgtcgaaatcaaaaggcaatgtgattgacccagttcaattaattgatcgttatggttta
gatgcgcttcgttattatttgttacgggaagttccttttggatcagatggtgtatttacg
ccagaaggattcgtagagcggacgaattatgatcttgcaaatgatttaggtaacttgtta
aatcgtaccgttgccatgattaataagtattttgccggtaaaatgccagcatatcgagcc
tcagaaacagaattcgatagcgcattagaagcgtttggcaaacaaacgatagaaaaagtg
gaagcagcaatggaggagatgcagttttctgtagcattaggagctatatggcaactaatt
agtcgtacaaataaatatattgatgagacagagccgtggatgttggcaaaagatgatgct
aacaaagaacgactaggaaatgtcatggcgcatttggctgagtatttacgtaaggcagct
gttatgctacagccatttctgacagaggctccagctgagattttccgtcagcttggtata
acagaggacaagctaaaagaatggaatagtctttatgaagaagggcatattacagcagaa
cgtatggttgtaagtaaaggcaagccaattttcccacgtttagatgcaaaagatgaaata
caagctattaaagcaatgatgaatccacctaaaacaaaggaagaaaaggtggaagataag
gcagaaaaagaacaaattgtgtttgatgattttatgaaaattgatatgcgtgtcgcagaa
atattacaagctgagcccgtaaagaaagcagataagttattgaaactacagttagattta
ggaacagagaagcgccaagttatctcaggcattgctgaacattacaaatctgaagaatta
gttggcaaaaaggtcatctgtgtaacgaatttgaagcctgttacattacgtggagaaaaa
tctgaaggaatgattctctctggagaggatgcgaccgggaagctatctttagcttctgtg
gagaactctcttccgaatggttccgttgtaaaatag

DBGET integrated database retrieval system