KEGG   Virgibacillus dokdonensis: A21D_02324Help
Entry
A21D_02324        CDS       T05261                                 

Gene name
ribBA
Definition
(GenBank) Riboflavin biosynthesis protein RibBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00740  Riboflavin metabolism
vpn00790  Folate biosynthesis
vpn01100  Metabolic pathways
vpn01110  Biosynthesis of secondary metabolites
Module
vpn_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    A21D_02324 (ribBA)
   00790 Folate biosynthesis
    A21D_02324 (ribBA)
Enzymes [BR:vpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     A21D_02324 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     A21D_02324 (ribBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: AUJ25388
UniProt: A0A2K9J099
Position
2487405..2488028
Genome map
AA seq 207 aa AA seqDB search
MDTIVEAIEDLKAGKPVIVIDDENRENEGDFVAISEYITPDAINFMITHGKGLVCTAVDC
KIAKRLGLTLMPTTHTDPFATAFTISVDHKKTTTGISAFDRATTIRALANPFSEKDDFHQ
PGHVFPLIAKDGGVFVRQGHTEAAVDLAKLCGATASGTICEIIHSDGSMARLSDLEKMAE
QFNVRIISVQQLVTYKITQNEECGVIE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatagtagaagcgatagaggacttaaaagcaggaaagccggtgattgtgata
gatgatgaaaaccgggaaaatgaaggggattttgttgctatatctgaatacattacgcca
gatgccattaattttatgataacacatggtaagggattagtatgcacagcggtagattgt
aaaatagcaaaacggcttggattaacattaatgccaacaacacatacagacccatttgca
actgcatttaccattagtgtcgatcataagaaaacaacaacaggtattagtgcatttgac
cgtgcgacaaccattcgtgcgcttgcgaaccctttctctgaaaaagatgattttcatcag
cctgggcatgtgtttccgttaattgctaaagatggtggtgtgtttgtacgtcaaggacat
acagaagctgcagtagatttagcaaaattatgtggagctacggcttcagggaccatatgt
gaaatcatccatagcgatggctcgatggcaaggctgtcggatttagagaaaatggctgaa
caatttaatgtaagaatcatttctgtacagcaattagtaacatataaaataacacaaaat
gaggagtgtggcgtcattgagtaa

DBGET integrated database retrieval system