KEGG   Virgibacillus dokdonensis: A21D_02618Help
Entry
A21D_02618        CDS       T05261                                 

Gene name
odhB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00020  Citrate cycle (TCA cycle)
vpn00310  Lysine degradation
vpn00380  Tryptophan metabolism
vpn01100  Metabolic pathways
vpn01110  Biosynthesis of secondary metabolites
vpn01120  Microbial metabolism in diverse environments
vpn01130  Biosynthesis of antibiotics
vpn01200  Carbon metabolism
Module
vpn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A21D_02618 (odhB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    A21D_02618 (odhB)
   00380 Tryptophan metabolism
    A21D_02618 (odhB)
Enzymes [BR:vpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A21D_02618 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N HlyD_3 PTS_EIIA_1 QRPTase_N NQRA
Motif
Other DBs
NCBI-ProteinID: AUJ25664
UniProt: A0A2K9J1R2
Position
2843264..2844526
Genome map
AA seq 420 aa AA seqDB search
MNEIKVPELAESITEGTIAEWLVKQGDKVEKGDPVVELETDKVNVEVNSEYSGVITEIIQ
VEGDDVEVGDVIAKIDENAEAGSVNTESAQGQADAKEEKQTEASPKQDIKEEAKKDFKEE
TQTSVDVIASPAARKRARELGIDLSKVSPRDPLGRIRPEDVEDAAKGTAKSSEQKEEKKP
IEKIEFDKPVERIKMSRRRQTIAKRLVEVQQEAAMLTTFNEVDLTNVMKLRSERKEKFIE
KHGVKLGFMSFFTKAVVGALKDFPLLNAEIQGNEIVMKKFYDIGIAVSTEDGLVVPVVRD
ADRLDFAGVEKEIGNLGKKARDKKLEMSDLQGGSFTITNGGTFGSMLSTPILNAPQVGIL
GMHNIQKRAVVMPDDSIEVRPMMYLALSYDHRIVDGKEAVQFLVRVKQLLEDPYDLLLEG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaataaaggtaccagagttagctgaatctattacagaaggaacaattgcggaa
tggttagtgaaacaaggggataaagtagaaaaaggcgatccagttgttgagctagaaaca
gataaagtgaatgtggaagtaaactctgaatattctggtgtaattacagaaataattcaa
gtcgaaggcgatgatgtagaagttggcgatgtcattgcaaaaattgacgaaaatgcagaa
gcaggaagtgtaaatacagaatctgctcaaggtcaagctgatgcaaaagaagaaaagcag
acagaagcctctcctaaacaagacataaaggaagaagcgaaaaaagacttcaaagaagag
acacaaacaagcgttgacgtaatcgcttcaccagctgctaggaagcgtgctagggagcta
ggtattgacctaagtaaggtgagcccacgtgacccattaggtcgcattcgcccagaagac
gtggaagatgctgcgaaaggtacagcaaaatcaagtgagcaaaaagaagagaagaagcct
atcgagaaaatagagtttgataagcctgttgaaagaattaaaatgtcccgtcgccgtcaa
actattgctaaacgtctagttgaagtacaacaagaagctgctatgcttacaacgtttaat
gaagtagatttaaccaatgttatgaagctgcgtagtgaacgtaaagagaagtttattgaa
aagcatggtgtgaagttaggcttcatgtctttctttacaaaagctgtcgttggtgcatta
aaagattttccattgcttaatgcagaaattcaaggtaatgaaatagtgatgaagaaattc
tatgatattggtattgcagtatctacagaagatggtttagtagttcctgtagtacgagat
gctgatcgtctcgattttgcaggagtggaaaaagaaattggtaatttaggtaagaaagcg
cgtgataagaagctagaaatgagtgacttacaaggtggttcatttacgattacaaatggt
ggaacatttggctctatgctttccacaccaatactaaatgcacctcaagtagggattcta
ggaatgcataatattcaaaaacgtgccgttgtgatgccagatgatagtatcgaagtacgt
ccaatgatgtatttagcgctatcctatgatcaccgtattgtagatggcaaagaggcggta
caattccttgttcgtgttaaacaattattagaagatccttacgatttattattagaagga
taa

DBGET integrated database retrieval system