KEGG   Virgibacillus dokdonensis: A21D_03421Help
Entry
A21D_03421        CDS       T05261                                 

Gene name
fhs1
Definition
(GenBank) Formate--tetrahydrofolate ligase 1
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vpn  Virgibacillus dokdonensis
Pathway
vpn00670  One carbon pool by folate
vpn01100  Metabolic pathways
vpn01120  Microbial metabolism in diverse environments
vpn01200  Carbon metabolism
Module
vpn_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A21D_03421 (fhs1)
Enzymes [BR:vpn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     A21D_03421 (fhs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AUJ26455
UniProt: A0A2K9J452
Position
3669936..3671606
Genome map
AA seq 556 aa AA seqDB search
MNKDIEIAQQTPLEPIHNIAEQLQLTSEDWEPYGHSKAKLSATLFEKLKQKKSGKIILVT
SINPTPAGEGKSTVTVGLGQALNQMRKNAIITLREPSLGPVMGIKGGAAGGGYSQVLPME
DINLHFTGDIHAITTANNALAALIDNHIHQGNELQIDPRKIEWKRVVDMNDRALRQIVVG
LGGAKQGVPREDGFNITVASEIMAILCLATDVQDLKERLRSIVIGYTFDHQPVTVSDLKV
EGALTLLLKDAIKPNLVQTTENTPAIIHGGPFANIAHGCNSIIATKMAAKLADYTITEAG
FGADLGAEKYFHIKSHAGNINTSAVVIVATVRALKMHGGVTKDRLMEENITALEAGMDNL
QKHIETIQAFNVPFVVAINQFPTDTKQETSFIQQWCEARGYDVALTTVWAHGGKGGIELA
KKVIAKANNSHSSFQPLYDINESLENKLRIVAQKVYGADDIEITKGARKQLRFFQEQGWS
NLPVCMAKNQYSLSDDPTLLGRPTGFTITIRELRASIGAGFIVALTGDVMTMPGLPAKPA
ALGMDVGEDGRAKGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggatattgaaattgcccaacaaacaccgttagagccaatacataacattgca
gagcaacttcaactaacttcagaggattgggaaccatatggacattcaaaagctaagctg
tcagcaaccttatttgagaaattaaaacaaaagaaaagcggaaagatcattttagtcaca
tcaattaatccaacacccgcaggagaaggaaaatcaacagttacggttggacttggacaa
gcattaaaccaaatgagaaagaatgcaattattacacttcgcgagccttcactaggtcca
gttatgggaattaaaggtggggcagcaggaggaggttattcccaagttttaccgatggaa
gatattaatttgcattttactggggatattcatgctataactacagcaaataacgcttta
gctgcattgattgacaatcatattcatcaaggcaatgaattacaaattgacccaagaaag
attgaatggaaacgagtagtagatatgaatgatcgcgctctaaggcagatcgttgttggt
ctaggtggagcaaaacaaggagttcctcgagaagatggtttcaatattaccgttgcatct
gaaattatggctatactctgcttagccaccgatgtacaagatttaaaagaaaggcttcgt
tcaatcgttatcggctatacattcgatcatcagcctgtcacagttagcgatttgaaagta
gaaggtgcattaactctgttattaaaagacgcaataaaaccaaaccttgtacaaacgaca
gaaaacacacctgctattattcatggcggcccatttgctaatatcgctcatggctgtaat
agcattattgcaacaaaaatggcggctaaattggcagattatacaataacagaagctggg
tttggggcggacttaggagctgaaaagtattttcatattaaatctcatgccggtaatatt
aatacctcagctgttgtcatcgtcgctactgtacgtgcgctaaaaatgcacggcggcgtt
acaaaagataggttgatggaggaaaacatcacagctttagaggctggcatggataattta
cagaaacatattgaaaccattcaggctttcaatgtaccatttgttgtagcaattaatcaa
tttccaaccgatacaaagcaggaaacatcatttattcagcaatggtgtgaagcgcgaggt
tatgatgttgcgctaaccactgtatgggctcatggaggaaaaggaggaatagagttagct
aaaaaagtaatcgctaaagcaaataattctcattcttcttttcaacctttatatgacata
aacgagtccctggaaaacaaattaagaatagtagctcagaaagtatatggggcagatgat
attgaaataacaaagggagcccgtaaacaattacgttttttccaagaacaaggttggagt
aatttgcctgtctgtatggctaaaaaccaatattcattatcagatgacccaacgttatta
gggagaccaacaggttttactattacaattagagagcttcgagcatctattggggccgga
tttattgtcgctttaactggtgacgtgatgacaatgccagggcttcctgccaaaccggct
gctttaggaatggatgtaggggaagatggacgagcaaaaggattattctaa

DBGET integrated database retrieval system