KEGG   Vanderwaltozyma polyspora: Kpol_1018p12Help
Entry
Kpol_1018p12      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00010  Glycolysis / Gluconeogenesis
vpo00030  Pentose phosphate pathway
vpo00051  Fructose and mannose metabolism
vpo00052  Galactose metabolism
vpo00680  Methane metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
vpo01230  Biosynthesis of amino acids
vpo03018  RNA degradation
Module
vpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kpol_1018p12
   00030 Pentose phosphate pathway
    Kpol_1018p12
   00051 Fructose and mannose metabolism
    Kpol_1018p12
   00052 Galactose metabolism
    Kpol_1018p12
  Energy metabolism
   00680 Methane metabolism
    Kpol_1018p12
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Kpol_1018p12
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kpol_1018p12
Protein phosphatases and associated proteins [BR:vpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Kpol_1018p12
Messenger RNA biogenesis [BR:vpo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Kpol_1018p12
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK UVR DAGK_cat
Motif
Other DBs
NCBI-GeneID: 5547839
NCBI-ProteinID: XP_001647342
UniProt: A7TDL4
AA seq 967 aa AA seqDB search
MTVTVPFVNGTSYSTLTAFSKDSFQEAVKFYKNLLALDQRTADDTSALLSNGPISIKLTL
KEDAALHADAMKARSHLLDPSISDDWRAKAPTSLVFNTMDITEVMNRFRALILPIQAFPN
DINPLLLYTVDPLGNVIGVTATKNAISTKPCVPASLLAEEQQKMKHELASKAVSYTDLSS
QFTKTTNAYPSLPTKTNASKADKAIAVMTSGGDAQGMNSNVRAIVRSAIFKGCRAFVVME
GYEGLVRGGPEYIKEVCWEDVRGWSTEGGTNIGTARCLEFRQREGRLLGAQHLIEAGVDA
LIVCGGDGSLTGADLFRSEWPSLIDELLKTNRISQEQYTRYQHLNICGTVGSIDNDMSTT
DATIGAYSALDRICTAVDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSADYIFIPE
NPPVPGKWQDGMCEIISQHRSHGKRTSIIIIAEGAIDTELNPIKPEDVHKVLCDRLKLDT
RITTLGHVQRGGTAVAYDRILATLQGVEAVNAVLESTADTPSPLIAINENKITRKPLIDS
VALTKSVADAIQAKDFEKAMSLRDTEFIEHFDNYMAINNADNGIPKLPADKRLKIAIVNV
GAPAGGINSAVYSMATYCMSQGHKPYAIYNGFSGLVRHESVRSLEWKDIIGWQSRGGSEI
GTNRVTPEEADIGMVAYYFQKYQFDGLIIVGGFEAFVSLNQLERGRDCYSAFRIPMVLIP
ATLSNNVPGTEYSLGSDTALNALMQYCDVVKQSAASTRGRVFVVDVQGGNSGYLATTAAL
AVGAQASYVPEEGISLPQLSQDIKMLGESFKEAKGRGRFGKIILKSTNASKALSAKQLAD
VISAEADGAFDAKVAIPGHVQQGGLPSPIDRTRATRLAVRAVSFIESRQDVMKASRAADE
EFDVDDKDVFETAAVLGVKGSHVVFTPIRQVYDNETDTDKRMPKIIHWQKTRDIADHLVG
RKKVNVK
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaactgtaccattcgttaacggtacttcttacagtactttaactgctttttca
aaagattctttccaagaagctgtcaaattttacaaaaatttattagctttagaccaacgt
actgcagatgatacctctgctttactatcaaatggtccaattagtattaaattaactttg
aaagaagatgcagctttacatgccgatgccatgaaagctcgttctcatcttttagatcct
tccatctctgacgattggagagctaaggctccaacttctttggttttcaacactatggat
attacagaagttatgaatagattcagagctttgatcttaccaattcaagctttcccaaat
gatattaacccattgttgttgtacactgtagatccattaggtaacgtcattggtgttaca
gctacaaagaatgccatcagtactaagccatgtgttccagcttctttacttgctgaagaa
caacaaaaaatgaaacacgaattggcttcaaaagctgtatcttacactgacttgtcttct
caattcaccaagactactaatgcttacccatccttaccaactaagaccaatgcttccaaa
gccgacaaagctattgctgttatgacctctggtggtgatgctcaaggtatgaactcaaac
gtcagagctattgttcgttctgctatcttcaaaggttgtcgtgcttttgtcgttatggaa
ggttacgaaggtttagttcgtggtggtccagaatacatcaaagaagtttgctgggaagat
gtccgtggttggtccactgaaggtggtaccaacatcggtactgcaagatgtttggaattc
agacaacgtgaaggtagattgttaggtgctcaacatttaatcgaagctggtgtcgacgct
ttgattgtctgtggtggtgacggttcattgactggtgctgatttattcagatctgaatgg
ccatctttaattgatgaattattgaagactaacagaatttctcaagaacaatacaccaga
tatcaacatttgaacatttgtggtactgttggttccattgacaatgatatgtctactact
gatgctaccatcggtgcttactctgctttggacagaatctgtactgctgtcgattacgtc
gaagctacagctaactcccattctagagctttcgttgtcgaagttatgggtagaaactgt
ggttggttagctttgttagctggtattgctacttctgctgattacatctttatcccggaa
aacccaccagttccaggtaaatggcaagacggcatgtgtgaaattatctcccaacacaga
tctcacggtaagagaacttctattattattattgctgaaggtgccatcgatactgaattg
aacccaattaagccagaagatgtccacaaggtcttgtgtgacagattgaaattagatacc
agaatcaccactttaggtcatgtccaaagaggtggtactgctgttgcctacgatcgtatt
ttggctactttgcaaggtgttgaagccgttaatgctgttttggaatccaccgctgataca
ccatctcctttaattgctattaacgagaacaagatcacccgtaaaccattgatcgactct
gttgctctaactaagtcagttgccgatgccattcaagctaaggacttcgaaaaggctatg
tcattaagagacactgaatttattgaacatttcgataactatatggccatcaacaatgct
gataatggtattccaaaattaccagctgacaagagattaaagattgctatcgttaacgtt
ggtgctccagctggtggtattaactctgccgtctattccatggctacttactgtatgtct
caaggtcacaaaccttatgctatatacaatggtttctccggtttagttagacatgaatct
gttcgttctctagaatggaaagatattatcggttggcaatctcgtggtggttctgaaatt
ggtaccaacagagtcaccccagaagaagctgatatcggtatggttgcttactacttccaa
aaataccaattcgatggtttgattattgtcggtggtttcgaagctttcgtttccttgaac
caattggaaagaggtagagactgttactctgctttcagaatcccaatggttttaatccca
gctactttgtctaataacgttccaggtactgaatattctttgggttctgatactgcatta
aatgccttaatgcaatactgtgatgttgttaagcaatccgctgcctccaccagaggtaga
gtattcgttgttgacgtccaaggtggcaattcaggttacttagccacaactgctgctttg
gctgttggtgctcaagcctcttatgttccagaagaaggtatctctttaccacaattatct
caagatatcaagatgttaggtgaatccttcaaggaagccaagggtagaggtagattcggt
aagattatcttgaagagtaccaatgcttcaaaggcattgagtgctaaacaattagcagat
gttatctctgctgaagctgacggtgctttcgacgctaaagttgccattccaggtcatgtc
caacaaggtggtttgccatctcctatcgatagaacaagggctaccagattggccgttaga
gccgttagtttcattgaatctcgtcaagatgtcatgaaggcttctcgtgctgccgatgaa
gaatttgatgtcgatgacaaagatgttttcgaaactgctgctgtcttgggtgttaaaggc
tctcacgttgtcttcactccaattagacaagtttacgataatgaaactgatacagacaag
agaatgccaaagatcatccactggcaaaagactagagacattgctgaccatttggtcggt
agaaagaaggttaacgtaaaataa

DBGET integrated database retrieval system